Oncorhynchus tshawytscha (Chinook salmon): 112216064 Help Entry 112216064         CDS       T05605                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-C-like   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112216064    04350 TGF-beta signaling pathway     112216064    04150 mTOR signaling pathway     112216064  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112216064   09144 Cellular community - eukaryotes    04510 Focal adhesion     112216064    04520 Adherens junction     112216064    04530 Tight junction     112216064   09142 Cell motility    04810 Regulation of actin cytoskeleton     112216064  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112216064    04625 C-type lectin receptor signaling pathway     112216064   09153 Circulatory system    04270 Vascular smooth muscle contraction     112216064  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112216064  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112216064   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112216064    04031 GTP-binding proteins [BR:otw04031]     112216064 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112216064 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112216064   Exosomal proteins of other body fluids (saliva and urine)    112216064   Exosomal proteins of colorectal cancer cells    112216064   Exosomal proteins of bladder cancer cells    112216064 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112216064 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  112216064 NCBI-ProteinID:  XP_024231466 LinkDB All DBs Position 16 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ AKKRGKKNACLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgcaatccgtaagaaactggtgattgttggtgatggtgcttgtggaaagacctgt ctgctcatagtcttcagtaaagaccagttccctgaggtctacgtacctacagtgtttgag aactatgtggcagatattgaggtggacagtaagcaggtggaactggccctctgggacaca gctggacaggaggactacgacagactacggcctctctcttaccctgacactgacgtcatc ctcatgtgcttttccatagatagccccgacagcttggagaatatcccagagaagtggacc cctgaagtaaaacacttctgtccaaatgtacccattattcttgtgggtaataagaaggac ctgcggaatgacgagcacacgcgtcgggagctagcaaaaatgaagcaggaaccagtgaag ccagaagaggcccgggacatggctaaccgcatcaacgcgtttggctacttggagtgctca gccaagacgaaagacggcgtgagggaggtgtttgagatggccaccagggctgcgctgcag gccaagaaacgtggaaagaagaatgcctgcctcctgctatag

Oncorhynchus tshawytscha (Chinook salmon): 112222049 Help Entry 112222049         CDS       T05605                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-C   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112222049    04350 TGF-beta signaling pathway     112222049    04150 mTOR signaling pathway     112222049  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112222049   09144 Cellular community - eukaryotes    04510 Focal adhesion     112222049    04520 Adherens junction     112222049    04530 Tight junction     112222049   09142 Cell motility    04810 Regulation of actin cytoskeleton     112222049  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112222049    04625 C-type lectin receptor signaling pathway     112222049   09153 Circulatory system    04270 Vascular smooth muscle contraction     112222049  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112222049  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112222049   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112222049    04031 GTP-binding proteins [BR:otw04031]     112222049 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112222049 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112222049   Exosomal proteins of other body fluids (saliva and urine)    112222049   Exosomal proteins of colorectal cancer cells    112222049   Exosomal proteins of bladder cancer cells    112222049 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112222049 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  112222049 NCBI-ProteinID:  XP_024240377 LinkDB All DBs Position 22 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ AKKRGKKNACLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgcgatccgtaagaagctggtgatcgtgggagatggtgcttgtgggaagacctgt ctgttgatagtcttcagtaaagaccagttccctgaggtctacgtacctacagtgtttgag aactatgtggcagatattgaggtggacagtaagcaggtagaactggccctctgggacaca gccggacaggaggactatgacagactaaggcctctctcctaccctgacactgatgtcatc ctcatgtgcttttccatagatagtcctgacagcttggagaatatcccagagaagtggacc cctgaagtaaagcacttctgtccaaatgtgcccatcattcttgtgggtaataagaaggac ttgcggaatgatgagcacacacgtcgggagttagcaaaaatgaagcaggaaccagtgaag ccagaggagggccgggacatggctaaccgcatcaacgcgtttggctacttggagtgctca gccaagacgaaagacggtgtgagggaggtgtttgagatggccaccagggcggcactgcag gccaagaaacgtggcaagaagaatgcctgtctcctgctatag

Oncorhynchus tshawytscha (Chinook salmon): 112222098 Help Entry 112222098         CDS       T05605                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-B   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112222098    04350 TGF-beta signaling pathway     112222098    04150 mTOR signaling pathway     112222098  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112222098   09144 Cellular community - eukaryotes    04510 Focal adhesion     112222098    04520 Adherens junction     112222098    04530 Tight junction     112222098   09142 Cell motility    04810 Regulation of actin cytoskeleton     112222098  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112222098    04625 C-type lectin receptor signaling pathway     112222098   09153 Circulatory system    04270 Vascular smooth muscle contraction     112222098  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112222098  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112222098   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112222098    04031 GTP-binding proteins [BR:otw04031]     112222098 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112222098 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112222098   Exosomal proteins of other body fluids (saliva and urine)    112222098   Exosomal proteins of colorectal cancer cells    112222098   Exosomal proteins of bladder cancer cells    112222098 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112222098 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  112222098 NCBI-ProteinID:  XP_024240479 LinkDB All DBs Position 22 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEARDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSNKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcgattcgtaagaagctggtgattgtgggagatggtgcttgtgggaagacctgt ctgttgatagtcttcagtaaagaccagttccctgaggtctacgtacccactgtctttgag aactatgtggctgacattgaggtggacagcaaacaggtggagctggctctgtgggataca gctggccaagaggactacgacaggcttcgccccctctcctaccccgacactgacgtcatc ctcatgtgcttctccattgacagcccagacagcttggagaacattccagagaagtggact ccagaagtcaaacacttctgtccaaatgttcccatcatcctcgtaggcaataagaaggac ctgcgcaacgatgaacacacacgccgggagctggccaagatgaaacaggagccagtgaag ccagaggaggcccgtgacatggccaaccggatcggagcgttcggctatatggagtgctcg gccaagacgaaggatggcgtgcgggaggtgtttgagatggccaccagggcggcactacag gcccggcgaggaaagaaaagcaataaatgtctccttctgtag

Oncorhynchus tshawytscha (Chinook salmon): 112232600 Help Entry 112232600         CDS       T05605                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-C-like   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112232600    04350 TGF-beta signaling pathway     112232600    04150 mTOR signaling pathway     112232600  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112232600   09144 Cellular community - eukaryotes    04510 Focal adhesion     112232600    04520 Adherens junction     112232600    04530 Tight junction     112232600   09142 Cell motility    04810 Regulation of actin cytoskeleton     112232600  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112232600    04625 C-type lectin receptor signaling pathway     112232600   09153 Circulatory system    04270 Vascular smooth muscle contraction     112232600  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112232600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112232600   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112232600    04031 GTP-binding proteins [BR:otw04031]     112232600 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112232600 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112232600   Exosomal proteins of other body fluids (saliva and urine)    112232600   Exosomal proteins of colorectal cancer cells    112232600   Exosomal proteins of bladder cancer cells    112232600 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112232600 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  112232600 NCBI-ProteinID:  XP_024255483 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ AKKRGKKNACLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgcaatccgtaagaaactggtgattgttggtgatggtgcttgtggaaagacctgt ctgctcatagtcttcagtaaagaccagttccctgaggtctacgtacctacagtgtttgag aactatgtggcagatattgaggtggacagtaagcaggtggaactggccctctgggacaca gctggacaggaggactacgacagactacggcctctctcttaccctgacactgacgtcatc ctcatgtgcttttccatagatagccccgacagcttggagaatatcccagagaagtggacc cctgaagtaaaacacttctgtccaaatgtacccattattcttgtgggtaataagaaggac ctgcggaatgacgagcacacgcgtcgggagctagcaaaaatgaagcaggaaccagtgaag ccagaagaggcccgggacatggctaaccgcatcaacgcgtttggctacttggagtgctca gccaagacgaaagacggcgtgagggaggtgtttgagatggccaccagggctgcgctgcag gccaagaaacgtggaaagaagaatgcctgcctcctgctatag

Oncorhynchus tshawytscha (Chinook salmon): 112244890 Help Entry 112244890         CDS       T05605                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112244890    04350 TGF-beta signaling pathway     112244890    04150 mTOR signaling pathway     112244890  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112244890   09144 Cellular community - eukaryotes    04510 Focal adhesion     112244890    04520 Adherens junction     112244890    04530 Tight junction     112244890   09142 Cell motility    04810 Regulation of actin cytoskeleton     112244890  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112244890    04625 C-type lectin receptor signaling pathway     112244890   09153 Circulatory system    04270 Vascular smooth muscle contraction     112244890  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112244890  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112244890   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112244890    04031 GTP-binding proteins [BR:otw04031]     112244890 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112244890 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112244890   Exosomal proteins of other body fluids (saliva and urine)    112244890   Exosomal proteins of colorectal cancer cells    112244890   Exosomal proteins of bladder cancer cells    112244890 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112244890 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  112244890 NCBI-ProteinID:  XP_024268520 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKQRNKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatccgaaagaagctggtcatagtgggagatggcgcatgtgggaagacgtgt ctgctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccactgtcttcgag aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgccccctatcttacccagatacagatgtcatc ctcatgtgcttctccatcgatagccctgacagtttggaaaacatcccagagaaatggact ccagaggtcaaacacttctgccctaacgttcccatcatcctagtgggcaacaaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggagggacgtgacatggcgaaccggatcagtgccttcggctacatggagtgctct gcaaagaccaaggatggcgtgagggaagtgtttgagatggccaccagggcggcgctacag gcccggcgggggaagcagagaaataaatgcctcctactgtaa

Oncorhynchus tshawytscha (Chinook salmon): 112254214 Help Entry 112254214         CDS       T05605                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-D   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112254214    04350 TGF-beta signaling pathway     112254214    04150 mTOR signaling pathway     112254214  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112254214   09144 Cellular community - eukaryotes    04510 Focal adhesion     112254214    04520 Adherens junction     112254214    04530 Tight junction     112254214   09142 Cell motility    04810 Regulation of actin cytoskeleton     112254214  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112254214    04625 C-type lectin receptor signaling pathway     112254214   09153 Circulatory system    04270 Vascular smooth muscle contraction     112254214  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112254214  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112254214   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112254214    04031 GTP-binding proteins [BR:otw04031]     112254214 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112254214 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112254214   Exosomal proteins of other body fluids (saliva and urine)    112254214   Exosomal proteins of colorectal cancer cells    112254214   Exosomal proteins of bladder cancer cells    112254214 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112254214 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  112254214 NCBI-ProteinID:  XP_024282320 LinkDB All DBs Position 7 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ VRKRKKRGACLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattaggaagaagctggtgatcgtgggggatggagcctgtggaaagacttgt cttctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccacagtgttcgag aactacatcgctgacatcgaggttgatggcaaacaggtggagctggcgctgtgggataca gccggccaggaggactacgacaggttgaggcctctctcctaccccgacacagatgtcatc ctcatgtgcttctctatcgacagccctgacagtttagaaaacatcccggagaagtggacc cctgaggtgaagcacttctgccccaacgttccaatcatcctggtgggcaacaagaaggac ctgaggaacgacgaacacacacggagggagctggccaagatgaagcaggagccagtgaag ccagaggagggccgggacatggctaaccgtatcagtgcctttggctacctggagtgttca gccaagaccaaggatggcgtgagggaggtttttgagatggccaccagggcggcgctgcag gtgcgcaagcgcaagaagaggggtgcctgcctgctgttgtga

Oncorhynchus tshawytscha (Chinook salmon): 112254254 Help Entry 112254254         CDS       T05605                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-D   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112254254    04350 TGF-beta signaling pathway     112254254    04150 mTOR signaling pathway     112254254  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112254254   09144 Cellular community - eukaryotes    04510 Focal adhesion     112254254    04520 Adherens junction     112254254    04530 Tight junction     112254254   09142 Cell motility    04810 Regulation of actin cytoskeleton     112254254  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112254254    04625 C-type lectin receptor signaling pathway     112254254   09153 Circulatory system    04270 Vascular smooth muscle contraction     112254254  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112254254  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112254254   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112254254    04031 GTP-binding proteins [BR:otw04031]     112254254 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112254254 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112254254   Exosomal proteins of other body fluids (saliva and urine)    112254254   Exosomal proteins of colorectal cancer cells    112254254   Exosomal proteins of bladder cancer cells    112254254 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112254254 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  112254254 NCBI-ProteinID:  XP_024282390 LinkDB All DBs Position 7 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ VRKRKKRGACLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattaggaagaagctggtgatcgtgggggatggagcctgtggaaagacttgt cttctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccacagtgttcgag aactacatcgctgacatcgaggttgatggcaaacaggtggagctggcgctgtgggataca gccggccaggaggactacgacaggttgaggcctctctcctaccccgacacagatgtcatc ctcatgtgcttctctatcgacagccctgacagtttagaaaacatcccggagaagtggacc cctgaggtgaagcacttctgccccaacgttccaatcatcctggtgggcaacaagaaggac ctgaggaacgacgaacacacacggagggagctggccaagatgaagcaggagccagtgaag ccagaggagggccgggacatggctaaccgtatcagtgcctttggctacctggagtgttca gccaagaccaaggatggcgtgagggaggtttttgagatggccaccagggcggcgctgcag gtgcgcaagcgcaagaagaggggtgcctgcctgctgttgtga

Oncorhynchus tshawytscha (Chinook salmon): 112254897 Help Entry 112254897         CDS       T05605                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism otw  Oncorhynchus tshawytscha (Chinook salmon) Pathway otw04144   Endocytosis otw04150   mTOR signaling pathway otw04270   Vascular smooth muscle contraction otw04310   Wnt signaling pathway otw04350   TGF-beta signaling pathway otw04510   Focal adhesion otw04520   Adherens junction otw04530   Tight junction otw04621   NOD-like receptor signaling pathway otw04625   C-type lectin receptor signaling pathway otw04810   Regulation of actin cytoskeleton otw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:otw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112254897    04350 TGF-beta signaling pathway     112254897    04150 mTOR signaling pathway     112254897  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112254897   09144 Cellular community - eukaryotes    04510 Focal adhesion     112254897    04520 Adherens junction     112254897    04530 Tight junction     112254897   09142 Cell motility    04810 Regulation of actin cytoskeleton     112254897  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112254897    04625 C-type lectin receptor signaling pathway     112254897   09153 Circulatory system    04270 Vascular smooth muscle contraction     112254897  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112254897  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:otw04131]     112254897   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:otw04147]     112254897    04031 GTP-binding proteins [BR:otw04031]     112254897 Membrane trafficking [BR:otw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112254897 Exosome [BR:otw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112254897   Exosomal proteins of other body fluids (saliva and urine)    112254897   Exosomal proteins of colorectal cancer cells    112254897   Exosomal proteins of bladder cancer cells    112254897 GTP-binding proteins [BR:otw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112254897 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  112254897 NCBI-ProteinID:  XP_024283628 LinkDB All DBs Position 7 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKSKDGVREVFEMATRAALQ ARRGKQRHKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgaaagaaactggtcatagtgggagacggagcgtgcgggaagacctgt ctgctcatcgtattcagtaaagaccagttcccagaggtctacgtgcccactgtcttcgag aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgtcccctctcttacccagatactgatgttatc ctcatgtgcttctccattgatagccccgacagtttggaaaacatcccggagaagtggact ccagaagtcaaacacttctgccctaacgttcccattatcctagtgggcaacaaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggaggggcgtgacatggcgaaccggatcagtgccttcggctacatggagtgctcc gcaaagagcaaggatggggtgagggaagtgtttgagatggccacgagggcggcgctacag gcccggcgggggaagcagagacataaatgcctcctactgtaa

DBGET integrated database retrieval system