KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216064
Entry
112216064         CDS       T05605                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-C-like
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112216064
   04350 TGF-beta signaling pathway
    112216064
   04150 mTOR signaling pathway
    112216064
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112216064
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216064
   04520 Adherens junction
    112216064
   04530 Tight junction
    112216064
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112216064
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112216064
   04625 C-type lectin receptor signaling pathway
    112216064
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112216064
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112216064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112216064
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112216064
   04031 GTP-binding proteins [BR:otw04031]
    112216064
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112216064
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112216064
  Exosomal proteins of other body fluids (saliva and urine)
   112216064
  Exosomal proteins of colorectal cancer cells
   112216064
  Exosomal proteins of bladder cancer cells
   112216064
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112216064
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 112216064
NCBI-ProteinID: XP_024231466
LinkDB
Position
16
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKKRGKKNACLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcaatccgtaagaaactggtgattgttggtgatggtgcttgtggaaagacctgt
ctgctcatagtcttcagtaaagaccagttccctgaggtctacgtacctacagtgtttgag
aactatgtggcagatattgaggtggacagtaagcaggtggaactggccctctgggacaca
gctggacaggaggactacgacagactacggcctctctcttaccctgacactgacgtcatc
ctcatgtgcttttccatagatagccccgacagcttggagaatatcccagagaagtggacc
cctgaagtaaaacacttctgtccaaatgtacccattattcttgtgggtaataagaaggac
ctgcggaatgacgagcacacgcgtcgggagctagcaaaaatgaagcaggaaccagtgaag
ccagaagaggcccgggacatggctaaccgcatcaacgcgtttggctacttggagtgctca
gccaagacgaaagacggcgtgagggaggtgtttgagatggccaccagggctgcgctgcag
gccaagaaacgtggaaagaagaatgcctgcctcctgctatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222049
Entry
112222049         CDS       T05605                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-C
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112222049
   04350 TGF-beta signaling pathway
    112222049
   04150 mTOR signaling pathway
    112222049
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112222049
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222049
   04520 Adherens junction
    112222049
   04530 Tight junction
    112222049
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112222049
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112222049
   04625 C-type lectin receptor signaling pathway
    112222049
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112222049
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112222049
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112222049
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112222049
   04031 GTP-binding proteins [BR:otw04031]
    112222049
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112222049
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112222049
  Exosomal proteins of other body fluids (saliva and urine)
   112222049
  Exosomal proteins of colorectal cancer cells
   112222049
  Exosomal proteins of bladder cancer cells
   112222049
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112222049
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 112222049
NCBI-ProteinID: XP_024240377
LinkDB
Position
22
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKKRGKKNACLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcgatccgtaagaagctggtgatcgtgggagatggtgcttgtgggaagacctgt
ctgttgatagtcttcagtaaagaccagttccctgaggtctacgtacctacagtgtttgag
aactatgtggcagatattgaggtggacagtaagcaggtagaactggccctctgggacaca
gccggacaggaggactatgacagactaaggcctctctcctaccctgacactgatgtcatc
ctcatgtgcttttccatagatagtcctgacagcttggagaatatcccagagaagtggacc
cctgaagtaaagcacttctgtccaaatgtgcccatcattcttgtgggtaataagaaggac
ttgcggaatgatgagcacacacgtcgggagttagcaaaaatgaagcaggaaccagtgaag
ccagaggagggccgggacatggctaaccgcatcaacgcgtttggctacttggagtgctca
gccaagacgaaagacggtgtgagggaggtgtttgagatggccaccagggcggcactgcag
gccaagaaacgtggcaagaagaatgcctgtctcctgctatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222098
Entry
112222098         CDS       T05605                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112222098
   04350 TGF-beta signaling pathway
    112222098
   04150 mTOR signaling pathway
    112222098
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112222098
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222098
   04520 Adherens junction
    112222098
   04530 Tight junction
    112222098
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112222098
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112222098
   04625 C-type lectin receptor signaling pathway
    112222098
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112222098
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112222098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112222098
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112222098
   04031 GTP-binding proteins [BR:otw04031]
    112222098
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112222098
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112222098
  Exosomal proteins of other body fluids (saliva and urine)
   112222098
  Exosomal proteins of colorectal cancer cells
   112222098
  Exosomal proteins of bladder cancer cells
   112222098
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112222098
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 112222098
NCBI-ProteinID: XP_024240479
LinkDB
Position
22
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEARDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcgattcgtaagaagctggtgattgtgggagatggtgcttgtgggaagacctgt
ctgttgatagtcttcagtaaagaccagttccctgaggtctacgtacccactgtctttgag
aactatgtggctgacattgaggtggacagcaaacaggtggagctggctctgtgggataca
gctggccaagaggactacgacaggcttcgccccctctcctaccccgacactgacgtcatc
ctcatgtgcttctccattgacagcccagacagcttggagaacattccagagaagtggact
ccagaagtcaaacacttctgtccaaatgttcccatcatcctcgtaggcaataagaaggac
ctgcgcaacgatgaacacacacgccgggagctggccaagatgaaacaggagccagtgaag
ccagaggaggcccgtgacatggccaaccggatcggagcgttcggctatatggagtgctcg
gccaagacgaaggatggcgtgcgggaggtgtttgagatggccaccagggcggcactacag
gcccggcgaggaaagaaaagcaataaatgtctccttctgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232600
Entry
112232600         CDS       T05605                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-C-like
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112232600
   04350 TGF-beta signaling pathway
    112232600
   04150 mTOR signaling pathway
    112232600
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112232600
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232600
   04520 Adherens junction
    112232600
   04530 Tight junction
    112232600
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232600
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112232600
   04625 C-type lectin receptor signaling pathway
    112232600
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112232600
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112232600
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112232600
   04031 GTP-binding proteins [BR:otw04031]
    112232600
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112232600
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112232600
  Exosomal proteins of other body fluids (saliva and urine)
   112232600
  Exosomal proteins of colorectal cancer cells
   112232600
  Exosomal proteins of bladder cancer cells
   112232600
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112232600
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 112232600
NCBI-ProteinID: XP_024255483
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKKRGKKNACLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcaatccgtaagaaactggtgattgttggtgatggtgcttgtggaaagacctgt
ctgctcatagtcttcagtaaagaccagttccctgaggtctacgtacctacagtgtttgag
aactatgtggcagatattgaggtggacagtaagcaggtggaactggccctctgggacaca
gctggacaggaggactacgacagactacggcctctctcttaccctgacactgacgtcatc
ctcatgtgcttttccatagatagccccgacagcttggagaatatcccagagaagtggacc
cctgaagtaaaacacttctgtccaaatgtacccattattcttgtgggtaataagaaggac
ctgcggaatgacgagcacacgcgtcgggagctagcaaaaatgaagcaggaaccagtgaag
ccagaagaggcccgggacatggctaaccgcatcaacgcgtttggctacttggagtgctca
gccaagacgaaagacggcgtgagggaggtgtttgagatggccaccagggctgcgctgcag
gccaagaaacgtggaaagaagaatgcctgcctcctgctatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244890
Entry
112244890         CDS       T05605                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112244890
   04350 TGF-beta signaling pathway
    112244890
   04150 mTOR signaling pathway
    112244890
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112244890
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112244890
   04520 Adherens junction
    112244890
   04530 Tight junction
    112244890
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112244890
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112244890
   04625 C-type lectin receptor signaling pathway
    112244890
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112244890
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112244890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112244890
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112244890
   04031 GTP-binding proteins [BR:otw04031]
    112244890
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112244890
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112244890
  Exosomal proteins of other body fluids (saliva and urine)
   112244890
  Exosomal proteins of colorectal cancer cells
   112244890
  Exosomal proteins of bladder cancer cells
   112244890
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112244890
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 112244890
NCBI-ProteinID: XP_024268520
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKQRNKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccatccgaaagaagctggtcatagtgggagatggcgcatgtgggaagacgtgt
ctgctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccactgtcttcgag
aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca
gcaggccaggaggactatgataggctccgccccctatcttacccagatacagatgtcatc
ctcatgtgcttctccatcgatagccctgacagtttggaaaacatcccagagaaatggact
ccagaggtcaaacacttctgccctaacgttcccatcatcctagtgggcaacaaaaaggac
ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag
ccagaggagggacgtgacatggcgaaccggatcagtgccttcggctacatggagtgctct
gcaaagaccaaggatggcgtgagggaagtgtttgagatggccaccagggcggcgctacag
gcccggcgggggaagcagagaaataaatgcctcctactgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254214
Entry
112254214         CDS       T05605                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112254214
   04350 TGF-beta signaling pathway
    112254214
   04150 mTOR signaling pathway
    112254214
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112254214
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254214
   04520 Adherens junction
    112254214
   04530 Tight junction
    112254214
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254214
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112254214
   04625 C-type lectin receptor signaling pathway
    112254214
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112254214
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112254214
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254214
   04031 GTP-binding proteins [BR:otw04031]
    112254214
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112254214
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254214
  Exosomal proteins of other body fluids (saliva and urine)
   112254214
  Exosomal proteins of colorectal cancer cells
   112254214
  Exosomal proteins of bladder cancer cells
   112254214
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112254214
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 112254214
NCBI-ProteinID: XP_024282320
LinkDB
Position
7
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRGACLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccattaggaagaagctggtgatcgtgggggatggagcctgtggaaagacttgt
cttctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccacagtgttcgag
aactacatcgctgacatcgaggttgatggcaaacaggtggagctggcgctgtgggataca
gccggccaggaggactacgacaggttgaggcctctctcctaccccgacacagatgtcatc
ctcatgtgcttctctatcgacagccctgacagtttagaaaacatcccggagaagtggacc
cctgaggtgaagcacttctgccccaacgttccaatcatcctggtgggcaacaagaaggac
ctgaggaacgacgaacacacacggagggagctggccaagatgaagcaggagccagtgaag
ccagaggagggccgggacatggctaaccgtatcagtgcctttggctacctggagtgttca
gccaagaccaaggatggcgtgagggaggtttttgagatggccaccagggcggcgctgcag
gtgcgcaagcgcaagaagaggggtgcctgcctgctgttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254254
Entry
112254254         CDS       T05605                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112254254
   04350 TGF-beta signaling pathway
    112254254
   04150 mTOR signaling pathway
    112254254
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112254254
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254254
   04520 Adherens junction
    112254254
   04530 Tight junction
    112254254
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254254
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112254254
   04625 C-type lectin receptor signaling pathway
    112254254
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112254254
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254254
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112254254
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254254
   04031 GTP-binding proteins [BR:otw04031]
    112254254
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112254254
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254254
  Exosomal proteins of other body fluids (saliva and urine)
   112254254
  Exosomal proteins of colorectal cancer cells
   112254254
  Exosomal proteins of bladder cancer cells
   112254254
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112254254
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 112254254
NCBI-ProteinID: XP_024282390
LinkDB
Position
7
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRGACLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccattaggaagaagctggtgatcgtgggggatggagcctgtggaaagacttgt
cttctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccacagtgttcgag
aactacatcgctgacatcgaggttgatggcaaacaggtggagctggcgctgtgggataca
gccggccaggaggactacgacaggttgaggcctctctcctaccccgacacagatgtcatc
ctcatgtgcttctctatcgacagccctgacagtttagaaaacatcccggagaagtggacc
cctgaggtgaagcacttctgccccaacgttccaatcatcctggtgggcaacaagaaggac
ctgaggaacgacgaacacacacggagggagctggccaagatgaagcaggagccagtgaag
ccagaggagggccgggacatggctaaccgtatcagtgcctttggctacctggagtgttca
gccaagaccaaggatggcgtgagggaggtttttgagatggccaccagggcggcgctgcag
gtgcgcaagcgcaagaagaggggtgcctgcctgctgttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254897
Entry
112254897         CDS       T05605                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112254897
   04350 TGF-beta signaling pathway
    112254897
   04150 mTOR signaling pathway
    112254897
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112254897
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254897
   04520 Adherens junction
    112254897
   04530 Tight junction
    112254897
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254897
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112254897
   04625 C-type lectin receptor signaling pathway
    112254897
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112254897
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112254897
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254897
   04031 GTP-binding proteins [BR:otw04031]
    112254897
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112254897
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254897
  Exosomal proteins of other body fluids (saliva and urine)
   112254897
  Exosomal proteins of colorectal cancer cells
   112254897
  Exosomal proteins of bladder cancer cells
   112254897
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112254897
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 112254897
NCBI-ProteinID: XP_024283628
LinkDB
Position
7
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKSKDGVREVFEMATRAALQ
ARRGKQRHKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcaatccgaaagaaactggtcatagtgggagacggagcgtgcgggaagacctgt
ctgctcatcgtattcagtaaagaccagttcccagaggtctacgtgcccactgtcttcgag
aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca
gcaggccaggaggactatgataggctccgtcccctctcttacccagatactgatgttatc
ctcatgtgcttctccattgatagccccgacagtttggaaaacatcccggagaagtggact
ccagaagtcaaacacttctgccctaacgttcccattatcctagtgggcaacaaaaaggac
ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag
ccagaggaggggcgtgacatggcgaaccggatcagtgccttcggctacatggagtgctcc
gcaaagagcaaggatggggtgagggaagtgtttgagatggccacgagggcggcgctacag
gcccggcgggggaagcagagacataaatgcctcctactgtaa

DBGET integrated database retrieval system