KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216155
Entry
112216155         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112216155
   04370 VEGF signaling pathway
    112216155
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112216155
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216155
   04520 Adherens junction
    112216155
   04530 Tight junction
    112216155
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112216155
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112216155
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112216155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112216155
   03036 Chromosome and associated proteins [BR:otw03036]
    112216155
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112216155
   04031 GTP-binding proteins [BR:otw04031]
    112216155
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112216155
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112216155
  Macropinocytosis
   Ras GTPases
    112216155
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112216155
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112216155
  Exosomal proteins of breast milk
   112216155
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112216155
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU PET117
Other DBs
NCBI-GeneID: 112216155
NCBI-ProteinID: XP_024231696
LinkDB
Position
16
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSSVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTVEKLAKNKQKPISPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKRRKCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacgattaaatgtgttgtggttggagatggagcggtgggaaaaacctgccttttg
atttcatacacaaccaacaagttcccctctgaatatgtaccaacagtgtttgataactat
gcagtaactgtcatgattggaggtgaaccttacactctaggattatttgatactgcgggt
caggaggattatgacaggttacggcctttgagctatccccagactgatgttttcctagtt
tgtttctctagtgtttcaccctcttcatttgagaatgttaaagaaaagtgggtacctgaa
atcactcaccactgtccgaagacaccattcctactggttggaactcagattgacctgaga
gatgacccttccacagtagagaagctggccaagaacaaacagaagcccatcagccctgag
acagctgagaagctcgcccgtgacctgaaagcagtcaaatacgttgagtgctctgcccta
acacagaaaggactaaagaatgtgtttgatgaggcaatactggctgccctggagcctccg
gaacccaagaagaggcgcaaatgtgtgctgctctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218284
Entry
112218284         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218284
   04370 VEGF signaling pathway
    112218284
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218284
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218284
   04520 Adherens junction
    112218284
   04530 Tight junction
    112218284
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112218284
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112218284
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112218284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112218284
   03036 Chromosome and associated proteins [BR:otw03036]
    112218284
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112218284
   04031 GTP-binding proteins [BR:otw04031]
    112218284
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112218284
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112218284
  Macropinocytosis
   Ras GTPases
    112218284
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112218284
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112218284
  Exosomal proteins of breast milk
   112218284
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112218284
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 112218284
NCBI-ProteinID: XP_024234710
LinkDB
Position
2
AA seq 192 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPIALETAEKLAKDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSANVCCYE
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaaacgatcaagtgtgttgtggtgggtgacggagctgtgggtaaaacctgtctgctc
atctcctacaccacaaacaagttcccctctgaatatgtacccacggtgtttgacaactat
gctgtaactgtaatgataggaggggagccctacaccctgggcttgtttgacactgcaggt
caggaggactacgacaggttacgacctctgagttatccccagacagatgtcttcctcgtc
tgtttctccgtcgtttccccctcctccttcgaaaatgtcaaagaaaagtgggttccagag
atcacccaccactgtccaaagaccccgttcctgttggtggggactcagatagatctgcga
gatgacccgtccaccatagagaagctggccaagaacaaacagaagcccatcgctcttgag
acggcagagaaactggccaaagaccttaaggccgtcaaatatgtggagtgctcagccctc
acgcagaaaggcctaaagaatgtgtttgatgaggcgatactggctgcgctggagcctccc
gagcccaagaagagcgcaaatgtgtgctgctatgaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221931
Entry
112221931         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221931
   04370 VEGF signaling pathway
    112221931
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112221931
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221931
   04520 Adherens junction
    112221931
   04530 Tight junction
    112221931
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112221931
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112221931
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112221931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112221931
   03036 Chromosome and associated proteins [BR:otw03036]
    112221931
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112221931
   04031 GTP-binding proteins [BR:otw04031]
    112221931
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112221931
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112221931
  Macropinocytosis
   Ras GTPases
    112221931
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112221931
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112221931
  Exosomal proteins of breast milk
   112221931
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112221931
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 112221931
NCBI-ProteinID: XP_024240155
LinkDB
Position
22
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSSVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTVEKLAKNKQKPISPEMAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKRRKCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacgattaaatgtgttgtggttggtgatggagcggtgggaaaaacctgccttttg
atttcatacacaaccaacaaattcccctctgaatatgtaccaacagtgtttgataactat
gcagtaactgtcatgattggcggtgagccgtacaccctaggattatttgatactgcaggt
caggaggattatgacaggttacgacctttgagctatccccagacggatgtttttctagtt
tgtttctctagtgtttcaccctcttcatttgagaatgttaaagaaaagtgggtacctgaa
atcactcaccactgtcccaagacaccattcctgctcgttggaactcagattgatctgaga
gatgacccttccacagtagagaagctggccaagaacaaacagaagcccatcagccctgag
atggctgagaagctcgcccgtgacctgaaggcagtcaaatatgttgagtgctctgccctg
acacagaaaggactaaagaatgtgtttgatgaggcaatactggctgccctggagcctccg
gaacccaagaagaggcgcaaatgtgtcctgctctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222725
Entry
112222725         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112222725
   04370 VEGF signaling pathway
    112222725
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112222725
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222725
   04520 Adherens junction
    112222725
   04530 Tight junction
    112222725
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112222725
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112222725
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112222725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112222725
   03036 Chromosome and associated proteins [BR:otw03036]
    112222725
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112222725
   04031 GTP-binding proteins [BR:otw04031]
    112222725
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112222725
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112222725
  Macropinocytosis
   Ras GTPases
    112222725
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112222725
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112222725
  Exosomal proteins of breast milk
   112222725
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112222725
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU PET117
Other DBs
NCBI-GeneID: 112222725
NCBI-ProteinID: XP_024241218
LinkDB
Position
23
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSCVSPSSFENVREKWVPEISHHCPRTPFLLVGTQVDLR
DDSNTVEKLAKNKQRPLSPESGDKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP
ETKPKKRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaataaagtgtgtagtggtgggggacggagctgtaggaaagacctgtctactt
atctcctacacaaccaacaagttcccctcagaatacgtgcctacggtgtttgataattat
gcagtgacggtgatgatcggaggggaaccctacacacttgggctttttgacacagcaggt
caggaggattacgataggctgcgacctctcagctacccgcagacggaygtcttcctcgtc
tgtttctcctgcgtctcaccctcatcctttgagaatgtccgagagaagtgggttccagag
atctcccatcactgtcctcgtacacccttcctgttggtgggcacccaggtggatctgagg
gacgacagcaacactgtggagaagctggccaagaacaaacagcggcccctgtcccctgag
agcggagacaagctggcccgggatctccgggccgtcaaatatgtggagtgctccgccctc
acgcagagggggctgaagaacgtgtttgacgaggccatcctggcagctttggaacctcct
gagactaaacccaagaaacgctgtgtcctgttataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229837
Entry
112229837         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112229837
   04370 VEGF signaling pathway
    112229837
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112229837
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229837
   04520 Adherens junction
    112229837
   04530 Tight junction
    112229837
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112229837
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112229837
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112229837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112229837
   03036 Chromosome and associated proteins [BR:otw03036]
    112229837
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112229837
   04031 GTP-binding proteins [BR:otw04031]
    112229837
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112229837
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112229837
  Macropinocytosis
   Ras GTPases
    112229837
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112229837
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112229837
  Exosomal proteins of breast milk
   112229837
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112229837
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 112229837
NCBI-ProteinID: XP_024251685
LinkDB
Position
31
AA seq 216 aa
MTRLLYSELSRANPRSNNAWWWTDKMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPT
VFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVRE
KWVPEISHHCPRTPFLLVGTQMDLRDDSNTVEKLAKNKQRPLAPESGDKLARDLRAVKYV
ECSALTQRGLKNVFDEAILAALEPPETKPKKRCALL
NT seq 651 nt   +upstreamnt  +downstreamnt
atgacacgcctcctttacagtgagctctcgcgagcgaaccccagatctaacaacgcctgg
tggtggactgataagatgcagaccataaagtgtgtggtggtgggtgacggtgcggtggga
aagacttgcctgttgatctcctacaccaccaacaagttcccttctgaatacgtccccacg
gtgtttgataactatgcggtgaccgtgatgatcggaggggagccctacactctggggctg
ttcgatacagcaggtcaggaggactatgacagactgcgaccactcagctacccccagaca
gacgtcttccttgtgtgtttctctgtcgtatcgccttcctcctttgagaacgtccgcgag
aagtgggtcccagagatctcccaccattgtccgcgtacacccttcctgctggtgggaacc
cagatggacctgagggacgacagcaacacagtggagaagctggctaagaacaagcagcgg
cccctggcccccgagagcggagacaagctggcccgggacctccgggccgtcaaatatgtg
gagtgctccgccctcacccagcgaggtctgaagaacgtgtttgatgaggccatcctggcg
gcgctggagccgccagagaccaagcccaagaaacgctgtgcactcttataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233276
Entry
112233276         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233276
   04370 VEGF signaling pathway
    112233276
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112233276
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233276
   04520 Adherens junction
    112233276
   04530 Tight junction
    112233276
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112233276
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112233276
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112233276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112233276
   03036 Chromosome and associated proteins [BR:otw03036]
    112233276
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112233276
   04031 GTP-binding proteins [BR:otw04031]
    112233276
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112233276
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112233276
  Macropinocytosis
   Ras GTPases
    112233276
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112233276
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112233276
  Exosomal proteins of breast milk
   112233276
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112233276
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 112233276
NCBI-ProteinID: XP_024256564
LinkDB
Position
Unknown
AA seq 216 aa
MTRLLYSELSRANPRSNNAWWWTDKMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPT
VFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVRE
KWVPEISHHCPRTPFLLVGTQMDLRDDSNTVEKLAKNKQRPLAPESGDKLARDLRAVKYV
ECSALTQRGLKNVFDEAILAALEPPETKPKKRCALL
NT seq 651 nt   +upstreamnt  +downstreamnt
atgacacgcctcctttacagtgagctctcgcgagcgaaccccagatctaacaacgcctgg
tggtggactgataagatgcagaccataaagtgtgtggtggtgggtgacggtgcggtggga
aagacttgcctgttgatctcctacaccaccaacaagttcccttctgaatacgtccccacg
gtgtttgataactatgcggtgaccgtgatgatcggaggggagccctacactctggggctg
ttcgatacagcaggtcaggaggactatgacagactgcgaccactcagctacccccagaca
gacgtcttccttgtgtgtttctctgtcgtatcgccttcctcctttgagaacgtccgcgag
aagtgggtcccagagatctcccaccattgtccgcgtacacccttcctgctggtgggaacc
cagatggacctgagggacgacagcaacacagtggagaagctggctaagaacaagcagcgg
cccctggcccccgagagcggagacaagctggcccgggacctccgggccgtcaaatatgtg
gagtgctccgccctcacccagcgaggtctgaagaacgtgtttgatgaggccatcctggcg
gcgctggagccgccagagaccaagcccaagaaacgctgtgcactcttataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237883
Entry
112237883         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237883
   04370 VEGF signaling pathway
    112237883
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112237883
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237883
   04520 Adherens junction
    112237883
   04530 Tight junction
    112237883
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237883
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112237883
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112237883
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112237883
   03036 Chromosome and associated proteins [BR:otw03036]
    112237883
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237883
   04031 GTP-binding proteins [BR:otw04031]
    112237883
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112237883
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112237883
  Macropinocytosis
   Ras GTPases
    112237883
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112237883
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112237883
  Exosomal proteins of breast milk
   112237883
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112237883
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU PET117
Other DBs
NCBI-GeneID: 112237883
NCBI-ProteinID: XP_024262246
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTEVFLVCFSCVSPSSFENVREKWVPEISHHCPRTPFLLVGTQVDLR
DDSNTVEKLAKNKQRPLSPESGDKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP
ETKSKKRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaataaagtgtgtagtggtgggggacggagctgtaggaaagacctgtctactt
atctcctacacaaccaacaagttcccctcagaatacgtgcctacggtgtttgataattat
gcagtgacggtgatgatcggaggggaaccctacacacttgggcttttcgacactgcaggt
caggaggattacgataggctgcgacctctcagctacccgcagacggargtcttcctcgtc
tgtttctcctgcgtctcaccctcatcctttgagaatgtccgagagaagtgggttccagag
atctcccatcactgtcctcgtacacccttcctgttggtgggcacccaggtggatctgagg
gacgacagcaacactgtggagaagctggccaagaacaaacagcggcccctgtcccctgag
agcggagacaagctggcccgggatctccgggccgtcaaatatgtggagtgctctgccctc
acgcagagggggctgaagaacgtgtttgacgaggccatcctggcagctttggaacctcct
gagactaaatccaagaaacgctgtgtcctgttataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254527
Entry
112254527         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254527
   04370 VEGF signaling pathway
    112254527
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112254527
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254527
   04520 Adherens junction
    112254527
   04530 Tight junction
    112254527
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254527
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112254527
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254527
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112254527
   03036 Chromosome and associated proteins [BR:otw03036]
    112254527
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254527
   04031 GTP-binding proteins [BR:otw04031]
    112254527
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112254527
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112254527
  Macropinocytosis
   Ras GTPases
    112254527
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112254527
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112254527
  Exosomal proteins of breast milk
   112254527
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112254527
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 112254527
NCBI-ProteinID: XP_024282962
LinkDB
Position
7
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKKRKCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacgatcaaatgtgttgtggtgggggatggagctgtgggtaaaacctgtctgctc
atctcctacaccacaaacaagttcccctctgaatacgtacccacggtgtttgacaactat
gctgtaactgtaatgataggaggggagccctacaccttggggttgtttgacactgcaggt
caggaggactatgacaggttacggcctctgagttacccccagacagacgtcttcctcgtc
tgtttctccgtcgtatccccctcttccttcgaaaacgtaaaagaaaagtgggttccagag
atcacccatcactgtccaaagaccccgttcctgttggtggggactcagatagatctgcga
gacgacccgtccaccatagagaagctggccaagaacaagcagaagcccatcactcctgag
acggcagaaaaactggccagagacctcaaggctgtcaaatacgttgagtgctcagctctc
acgcagaaaggcctaaagaatgtgtttgatgaggcgatactggctgcgctggagcctccc
gagcccaagaagaaacgcaaatgtgtgctgctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264818
Entry
112264818         CDS       T05605                                 

Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112264818
   04370 VEGF signaling pathway
    112264818
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112264818
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112264818
   04520 Adherens junction
    112264818
   04530 Tight junction
    112264818
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112264818
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112264818
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112264818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112264818
   03036 Chromosome and associated proteins [BR:otw03036]
    112264818
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112264818
   04031 GTP-binding proteins [BR:otw04031]
    112264818
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112264818
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    112264818
  Macropinocytosis
   Ras GTPases
    112264818
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112264818
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   112264818
  Exosomal proteins of breast milk
   112264818
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112264818
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 112264818
NCBI-ProteinID: XP_024297442
LinkDB
Position
13
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVREKWVPEISHHCPRTPFLLVGTQMDLR
DDSNTVEKLAKNKQRPLAPESGDKLCRDLRAVKYVECSALTQRGLKNVFDEAILAALEPP
ETKPKKRCTLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagaccataaagtgtgtggtagtgggtgacggtgcagtgggaaagacctgcctgttg
atctcctacaccaccaacaagttcccctcggaatacgtccccacggtgtttgataactat
gcagtgacagtgatgatcggaggggagccctacactctggggctgttcgatacagcaggt
caggaggactatgacagactgcgaccactcagctaccctcagacagatgtcttcctggtg
tgcttctctgttgtatcaccttcctcttttgagaatgtccgtgagaagtgggtcccagag
atctcccaccattgtccgcgtacacccttcctgctggtgggcacccagatggacctgagg
gacgacagcaacacagtggagaagctggctaagaacaagcagcggcccctggcccctgag
agcggagacaagctgtgccgggacctccgggccgtcaaatacgttgagtgctccgccctc
acccagcgaggtctgaagaacgtgtttgatgaggccatcttggccgcgctggagccgcca
gagaccaagcccaagaaacgctgcacactcttataa

DBGET integrated database retrieval system