KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216212
Entry
112216212         CDS       T05605                                 

Definition
(RefSeq) ras-related protein Rap-1A-like
  KO
K04353  Ras-related protein Rap-1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112216212
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216212
   04530 Tight junction
    112216212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112216212
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    112216212
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha
Other DBs
NCBI-GeneID: 112216212
NCBI-ProteinID: XP_024231813
LinkDB
Position
16
AA seq 185 aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPIEKKKAKKKS
NCTLL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcgtgaatacaagctagtggtgttaggctccggaggtgtcggcaaatctgcactgaca
gtccaatttgtacaaggtatttttgtggaaaaatatgaccccacaatagaagactcctac
agaaagcaagttgaagtggacgggcagcaatgcatgcttgaaatccttgacacagctgga
acagagcagttcacagcaatgagggacctgtacatgaagaacggtcaaggcttcgctctt
gtatactccatcactgcacagtccacgtttaatgacctacaggacctgagggaacagatc
ctgagagtaaaggacactgaggatgtccccatgatcctggtaggcaacaagtgtgacctg
gaggatgagcgtgtggtgggcaaagagcagggacagaacctggccagacagtggaacaac
tgtgcctttctagagtcctccgctaaatcaaagatcaacgttaatgagattttctatgac
ctggtcagacagatcaataggaaaacgccgatagaaaagaagaaagcaaagaagaagtca
aattgcacactgctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221097
Entry
112221097         CDS       T05605                                 

Definition
(RefSeq) ras-related protein Rap-1A-like
  KO
K04353  Ras-related protein Rap-1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221097
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221097
   04530 Tight junction
    112221097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112221097
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    112221097
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha
Other DBs
NCBI-GeneID: 112221097
NCBI-ProteinID: XP_024238979
LinkDB
Position
2
AA seq 185 aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNHCAFLESSAKSKINVLDIFYDLVRQINSKTPVEKKKAKKKS
NCVLL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcgtgaatacaagctagtggtgctaggctcgggaggcgtgggcaagtccgctctgaca
gtccagtttgtgcagggaatctttgtggaaaagtatgacccaacaatagaagactcctac
agaaagcaagtggaggtagatggacagcagtgcatgcttgaaatccttgacacagccggc
acagagcagttcactgccatgagagatctgtacatgaagaacggtcagggctttgccctg
gtatactccatcacagcacagtccacgttcaacgacctgcaggacctgagggaacagatc
ttgagagtcaaggacactgaagatgtgcctatgatcctggtgggtaataagtgtgacctg
gaggatgagcgggtggtgggcaaggagcagggtcagaacctggccagacagtggaaccac
tgtgcctttttagagtcctccgcaaagtcaaagatcaacgtcctcgacatcttctacgac
ttggtcagacagataaatagtaaaacgcctgttgaaaagaagaaagcgaaaaagaaatca
aactgtgtcctgctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221873
Entry
112221873         CDS       T05605                                 

Definition
(RefSeq) ras-related protein Rap-1b isoform X1
  KO
K04353  Ras-related protein Rap-1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221873
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221873
   04530 Tight junction
    112221873
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112221873
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    112221873
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha
Other DBs
NCBI-GeneID: 112221873
NCBI-ProteinID: XP_024240038
LinkDB
Position
22
AA seq 184 aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPIERKKEKKSN
CTLL
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcgtgaatacaagctagtggttttaggctcaggaggtgtaggcaaatctgcactgact
gtccaatttgtacagggtatttttgtggaaaaatatgaccccacaatagaagactcctac
agaaagcaagttgaagtggatgggcagcagtgcatgcttgaaatccttgacacagctgga
acagagcagttcacagcgatgagggacttgtacatgaagaacggtcaaggcttcgctctt
gtatactccatcacggcgcagtccacatttaatgatctacaggaccttcgggaacagatc
ctgagagtaaaggacactgaggatgtccccatgatcctggtgggcaacaagtgtgacctg
gaggatgagcgtgtggtgggcaaggagcagggtcagaacctggccagacagtggaacaac
tgtgcctttctagagtcctcagctaaatcaaagatcaacgttaatgagattttctatgac
ctggtcagacagatcaataggaaaacaccgatagaaaggaagaaggaaaagaagtcaaat
tgcacactgctctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254221
Entry
112254221         CDS       T05605                                 

Definition
(RefSeq) ras-related protein Rap-1A-like
  KO
K04353  Ras-related protein Rap-1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254221
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254221
   04530 Tight junction
    112254221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112254221
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    112254221
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha
Other DBs
NCBI-GeneID: 112254221
NCBI-ProteinID: XP_024282334
LinkDB
Position
7
AA seq 185 aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNHCAFLESSAKSKINVLDIFYDLVRQINRKTPVEKKKAKKKS
NCVLL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcgtgaatacaagctagtggtgctaggctcgggaggcgtgggcaaatccgctctgaca
gtccagtttgtacagggaatctttgtggaaaaatatgacccaacaatagaagactcctac
agaaagcaagtggaggtagatggacagcaatgcatgcttgaaatcctcgacacagccggc
acagagcagttcactgcaatgagagatctgtacatgaagaacggtcagggctttgccctg
gtgtactccatcacagcacagtccacgttcaacgacctgcaggacctgagggaacagatc
ctgagagtgaaggacaccgaagatgtgccgatgatcctggtggggaataagtgtgacctg
gaggatgagcgggtggtgggcaaggagcagggtcagaacctggccagacagtggaaccac
tgtgcctttttagagtcctccgcaaagtcaaagatcaacgtcctcgacatcttctatgac
ttggtcagacagataaataggaaaacgcctgtggaaaagaagaaagcgaaaaagaaatca
aactgtgtcttgctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254261
Entry
112254261         CDS       T05605                                 

Definition
(RefSeq) ras-related protein Rap-1A-like
  KO
K04353  Ras-related protein Rap-1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254261
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254261
   04530 Tight junction
    112254261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112254261
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    112254261
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha
Other DBs
NCBI-GeneID: 112254261
NCBI-ProteinID: XP_024282403
LinkDB
Position
7
AA seq 185 aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNHCAFLESSAKSKINVLDIFYDLVRQINRKTPVEKKKAKKKS
NCVLL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcgtgaatacaagctagtggtgctaggctcgggaggcgtgggcaaatccgctctgaca
gtccagtttgtacagggaatctttgtggaaaaatatgacccaacaatagaagactcctac
agaaagcaagtggaggtagatggacagcaatgcatgcttgaaatcctcgacacagccggc
acagagcagttcactgcaatgagagatctgtacatgaagaacggtcagggctttgccctg
gtgtactccatcacagcacagtccacgttcaacgacctgcaggacctgagggaacagatc
ctgagagtgaaggacaccgaagatgtgccgatgatcctggtggggaataagtgtgacctg
gaggatgagcgggtggtgggcaaggagcagggtcagaacctggccagacagtggaaccac
tgtgcctttttagagtcctccgcaaagtcaaagatcaacgtcctcgacatcttctatgac
ttggtcagacagataaataggaaaacgcctgtggaaaagaagaaagcgaaaaagaaatca
aactgtgtcttgctctaa

DBGET integrated database retrieval system