KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216259
Entry
112216259         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase 2-like isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112216259
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112216259
   04114 Oocyte meiosis
    112216259
   04115 p53 signaling pathway
    112216259
   04218 Cellular senescence
    112216259
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112216259
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112216259
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112216259
   03036 Chromosome and associated proteins [BR:otw03036]
    112216259
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112216259
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112216259
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112216259
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112216259
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kinase-like
Other DBs
NCBI-GeneID: 112216259
NCBI-ProteinID: XP_024231882
LinkDB
Position
2
AA seq 297 aa
MELFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLCDVIHTENKLYLVFEFLHQDLKKFMDSSVSGISLPLVKSYLFQLLQGLAFCHSH
RVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYS
TAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVAWPGVTSMPDYKPSFP
KWARQELSKVVPPLDEDGRELLRQMLSYDPNKRISAKNALVHRFFRDVTMPMPHLRL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaattatttcagaaagtggaaaagattggagaagggacgtacggggtggtgtacaag
gcaaagaacaaagtcacgggagagactgttgccctcaagaaaatcagactagacacggaa
acagagggagtaccaagcactgccatcagagagatatcgctcctcaaagagctcagccac
ccaaatattgtcaagctctgtgatgtcatccacacagagaacaaactgtacctggttttt
gagttccttcatcaggaccttaagaagttcatggactcctcggtctctggtatctctctg
ccacttgtcaagagttacctgttccagctgctgcagggcctggccttctgtcactcccac
agggttctccatcgggacctgaagccccagaaccttctcattaacgcccagggggagatc
aagctggctgacttcggccttgctagggcctttggggtgcctgtccgcacctacactcat
gaggtggtaactctatggtaccgagctccagaaattcttttgggctgcaaatactactcc
acagcggttgacatctggagtttgggctgtatctttgctgaaatgataaccaggagggcc
ttgtttccaggcgactcagagatcgatcagctgttccggatcttccgtaccctgggcaca
ccggacgaggtggcttggccaggggtcacttccatgcctgactacaagccctccttcccc
aagtgggcccgacaggagctgtccaaagtggttcccccactggacgaggacgggagagag
ctgctcaggcaaatgctgagctatgacccaaacaagaggatatctgccaaaaatgccctt
gtccatcgttttttccgtgacgtcaccatgccaatgccacacctacgactgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254710
Entry
112254710         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112254710
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112254710
   04114 Oocyte meiosis
    112254710
   04115 p53 signaling pathway
    112254710
   04218 Cellular senescence
    112254710
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112254710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112254710
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112254710
   03036 Chromosome and associated proteins [BR:otw03036]
    112254710
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112254710
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112254710
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112254710
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112254710
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kdo
Other DBs
NCBI-GeneID: 112254710
NCBI-ProteinID: XP_024283262
LinkDB
Position
7
AA seq 298 aa
MESFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVELRDVIHTENKLYLVFEFLHQDLKKFMDSSSVSGIALPLVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEAAWPGVTSMPDYKPSF
PKWARQELSKVVPPLDDDGRELLGQMLAYDPNKRISAKNALVHRFFRDVTMPMPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaatcatttcagaaagtggaaaagattggcgaagggacgtacggagtggtgtacaag
gcaaagaacaaagtcactggagagaccgttgccctcaagaaaatcagactagacacggaa
acagagggtgtaccaagcactgccatccgagagatatcactcctcaaagagctcagccac
ccaaatattgttgagctccgtgatgtcatccacacagagaacaaactgtacctggttttt
gagttcctacatcaggacctcaagaagttcatggactcctcctctgtctctggtatcgct
ttgccacttgtcaagagttacctgttccagctgctacagggcctggccttctgtcactcc
cacagggttctccatcgggatctgaagccccagaacctgctcatcaatgcccagggggag
atcaagcttgctgacttcggcctggctagggccttcggtgtgcctgtccgcacctacact
catgaggtggtaactctatggtaccgagctccagaaattctcttgggctgcaaatactac
tctacagctgttgacatctggagtttgggttgcatctttgctgaaatgatcactaggagg
gccttgtttccaggtgactccgagatcgatcagctgttccgaatcttccgtaccctgggt
actccggatgaggcggcctggccaggagtcacctccatgcccgactacaagccctccttc
ccaaagtgggcccggcaggagctgtccaaagtggtgccccctctggatgacgacgggaga
gagcttcttgggcaaatgctggcctatgacccaaacaagaggatatctgcaaaaaatgcc
cttgtccatcggttcttccgtgacgtcaccatgccaatgccacacctacgactctga

DBGET integrated database retrieval system