KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216306
Entry
112216306         CDS       T05605                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112216306
   04370 VEGF signaling pathway
    112216306
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112216306
   04137 Mitophagy - animal
    112216306
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216306
   04520 Adherens junction
    112216306
   04530 Tight junction
    112216306
   04540 Gap junction
    112216306
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112216306
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112216306
  09152 Endocrine system
   04912 GnRH signaling pathway
    112216306
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112216306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112216306
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112216306
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112216306
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  SRC family
   112216306
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112216306
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    112216306
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112216306
  Macropinocytosis
   Kinases
    112216306
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 112216306
NCBI-ProteinID: XP_024231968
LinkDB
Position
16
AA seq 533 aa
MGGTKSKPKDISSGGGAGSLNFSPAQHTLTSNRNPAVDGTRQPTQPLTNTPELALFGGAE
STSSVTSPNRGTLAGGVTTFVALYDYESRTASDLSFRKGERLQIVNNTRKLNSREGDWWL
ARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLGLENRKGTFLVRESETT
KGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFNNLQQLVLHYHKHADGLCHC
LTEVCPVLKPQTQGLARDAWEIPRDSLRLDLKLGQGCFGEVWMGTWNGTTRVAIKTLKTG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMGQGSLLDFLKGDMGKMLRL
PQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNMVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNREVLDQVERGYR
MPCPAECPESLHDLMLTCWRKDAEERPTFEYLQGFLEDYFTSTEPQYQPGENL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggaggaaccaaaagcaagcccaaagacatcagctcgggaggaggggctggtagcctc
aacttcagccctgcccagcacaccctcacatccaatcggaaccctgcagtggacgggaca
cgccagcccactcagcctctgaccaataccccggagctggccctgtttgggggtgcagag
tccaccagtagcgtcacgtctcctaacagagggacacttgcaggaggagtgacgacgttc
gtggcgctgtatgactacgagtctcgcactgcctctgatctgtctttcaggaagggcgag
cggctacagatagtaaacaacacgagaaagttgaacagcagagaaggggactggtggctg
gctcgatctctgactacgggagaaagcggttacatccccagcaattatgtggctccctcc
gactccatccaggcagaagagtggtattttgggaagatcacacgtcgcgattcggagcgg
ctcttgttgggtctggagaacaggaaaggaacgttcttggtgagagagagcgagaccacc
aaaggtgcctactgtctgtcagtcttggactatgacaacactaaagggctgaacgtgaaa
cattacaagatcaggaagctggacagtggagggttctacatcacctcacgcactcagttt
aacaacctacagcagcttgtcttacactaccacaagcatgcagacggactgtgccactgt
ctgacagaggtgtgtcccgtactgaagcctcagacccagggcctagcacgcgatgcctgg
gagatccccagggactccctccgcctcgacctcaaactgggacagggatgcttcggagag
gtctggatgggcacgtggaatggtacgacgcgggtagcaatcaagaccctgaagacgggt
accatgtcccccgaggccttcctccaggaggctcaggtcatgaagaagctgagacatgag
aagcttgtccagctctatgctgtggtgtctgaagaacccatctatattgttactgagtac
atgggacaagggagcttattggacttcctgaagggagacatgggcaagatgctccgcctt
cctcagctggtagacatggcctcacagattgcctcagggatggcgtacgtagagaggatg
aactacgtccacagagacctcagggctgccaacatcctagtgggagacaacatggtgtgt
aaagtggctgatttcggcctggcccgcctcatagaagacaacgagtacactgccaggcag
ggagcaaagttccccatcaagtggacagcccctgaagctgcgctgtatggccgcttcact
atcaagtctgacgtctggtcgttcggggtcttgctgaccgagctggccactaaaggcaga
gtaccatatccaggcatggtgaatcgggaggtgttggaccaggtggagcgtggttacagg
atgccctgtccagctgagtgccctgagtccctccacgacctcatgttgacctgctggagg
aaggacgccgaggagcggcccacctttgagtacctgcagggcttcctggaagactacttc
acctccactgagccccagtaccagcctggagagaacctgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221781
Entry
112221781         CDS       T05605                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112221781
   04370 VEGF signaling pathway
    112221781
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112221781
   04137 Mitophagy - animal
    112221781
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221781
   04520 Adherens junction
    112221781
   04530 Tight junction
    112221781
   04540 Gap junction
    112221781
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112221781
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112221781
  09152 Endocrine system
   04912 GnRH signaling pathway
    112221781
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112221781
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112221781
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112221781
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112221781
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  SRC family
   112221781
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112221781
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    112221781
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112221781
  Macropinocytosis
   Kinases
    112221781
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 112221781
NCBI-ProteinID: XP_024239868
LinkDB
Position
22
AA seq 544 aa
MGGTKSKPKDAGLRTRSLDGNISLGGGGGSYNISPAQHTLTPNLSPAVGGTRRSTQPLIN
TPELALFGGVESANSVTSPNRGTLAGGVTTFMALYDYESRTASDLSFRKGERLQIVNNMR
KLNSREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLSLDNRR
GTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFNNIHQLVTH
YHKHADGLCHCLTEVCPVLKPQTQGLARDAWEIPRDSLCLDLKLGQGCFGEVWMGTWNGT
TRVAVKTLKTGTMSPEAFLMEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMGQGSLLDF
LKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLAR
LIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNR
EVLDQVERGYRMPCPAECPDSLHDLMLTCWRKDAEERPTFEYLQGFLEDYFTSTEPQYQP
GENL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggggggaaccaagagcaagcccaaagacgcaggccttcggacacggagtcttgatggt
aacatcagtttaggaggagggggtggcagctacaacatcagccccgcccagcacaccctc
acgcccaatctgagtccagcagtgggcggaacacgccggtccactcagccgttgatcaat
accccggagctggcactgtttgggggagtggagtccgccaatagtgtcacgtctcctaac
agagggacacttgcaggaggtgtgacgacgttcatggcgctgtatgactacgagtctcgc
actgcctccgatctgtctttcaggaagggggaacggctacaaatagtgaacaacatgaga
aagttgaacagcagagaaggggactggtggctggctcgctctctgaccactggagaaagt
ggttacatccccagcaattatgtggctccttccgactccatccaggcagaagagtggtat
tttgggaagatcacacgtcgcgactcggagaggctcctcttgagtttggacaacaggaga
gggacgttcctggtgagagagagtgagaccaccaaaggtgcctactgtctgtcagtcctg
gactatgacaacactaaaggactgaatgtgaaacactacaagattagaaagctggacagt
ggaggcttctacatcacctcacgcactcagtttaacaacatacatcagctggtcacacac
taccacaagcatgcagacggactgtgccactgtctgacggaggtatgtcccgtactaaag
cctcagacccaggggctggcccgcgatgcctgggagatccccagggactctctatgcctc
gacctcaaactgggacagggatgcttcggagaggtctggatgggcacgtggaacgggaca
acgcgggtagcggtcaagaccctgaagacaggtaccatgtcccccgaggcattccttatg
gaggcccaggtcatgaagaagctgagacatgaaaaactggtccagctgtacgccgtggtg
tctgaagaacctatctatattgtcacggagtacatgggacaaggaagcttgttggacttc
ctgaagggagacatgggcaagatgctccgccttcctcagctggttgacatggcctcacag
attgcctcaggaatggcgtatgtagagaggatgaactacgtccacagagacctcagggct
gccaacattctagtgggagacaacttggtttgtaaagtggctgactttggactggcccgt
ctcatagaggacaatgagtacactgccaggcagggagcaaagttccccatcaagtggacg
gctcctgaagccgcgctgtatggccgcttcaccatcaaatcagacgtctggtcattcggg
gtcttactgacagaactggccaccaaggggagagtaccatatccaggcatggtgaatcgg
gaggtgctggaccaggtggaacgtggttacaggatgccttgtcctgctgagtgccctgac
tccctccatgacctcatgctcacctgctggaggaaggacgctgaggagaggcccacattc
gagtacctgcagggcttcctggaagactactttacctccactgagccacagtaccagccc
ggggagaacctttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255048
Entry
112255048         CDS       T05605                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112255048
   04370 VEGF signaling pathway
    112255048
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112255048
   04137 Mitophagy - animal
    112255048
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255048
   04520 Adherens junction
    112255048
   04530 Tight junction
    112255048
   04540 Gap junction
    112255048
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112255048
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112255048
  09152 Endocrine system
   04912 GnRH signaling pathway
    112255048
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112255048
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112255048
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112255048
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112255048
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  SRC family
   112255048
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112255048
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    112255048
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112255048
  Macropinocytosis
   Kinases
    112255048
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 112255048
NCBI-ProteinID: XP_024283867
LinkDB
Position
7
AA seq 548 aa
MGAGKSKPKEPGQRSLSLDGTIGTGSDSGHHHHLNSTQQTQTPNRSPAVGGARHGHHPGN
APTNTPELALFGGVDHAGSITSPHRGPLAGGVTTFVALYDYESRTASDLTFKKGERLQII
NNTRKYSFREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLSL
QNRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQ
LVYHYHKHADGLCHCLTEVCPMLKPQTQGLARDAWEISRESLHLDLKLGQGCFGEVWMGT
WNGTTRVAIKTLKTGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQGS
LLDFLKGDTGKLLRLPQLVDMASQIAAGMAYVERMNYVHRDLRAANILVGDNLACKVADF
GLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPG
MVNREVLDQVERGYRMPCPAECPASMHELMLTCWRKDAEERPTFEYLQGFLEDYFTSTEP
QYQPGENL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgggggcgggcaagagcaagcccaaggagccaggccagcgctcactgagtcttgatggc
accattggcacgggctcggacagtgggcaccaccaccacctcaactcgacccagcagacc
cagacccccaacaggagtcccgccgtagggggcgccagacatggccaccaccccgggaat
gctcccaccaacacccctgagctggcgctgttcggtggagtagaccacgcgggcagtatc
acctcccctcacagaggaccactggcaggaggtgtcactacatttgtggcactctatgac
tatgaatcacggactgcctcagacctgaccttcaagaaaggcgagcggctgcagatcatc
aacaacacgagaaagtacagcttcagggaaggggactggtggctggctcggtctctgact
accggagaaagcggttacatccccagcaactatgtggccccctctgactccattcaagca
gaagagtggtattttgggaaaataactcggcgcgactcagagaggctccttttgagttta
cagaaccgacgaggcaccttcctggtccgagagagcgagaccaccaagggagcctactgc
ctgtccgtgttggactacgacaacaccaaaggtctcaacgtcaaacattacaagatacgc
aagctagacagcggtggtttctacatcacctcacgcacccagttcagcagcctgcagcag
ctggtctaccactatcataagcatgcagatggactgtgccactgtctgacagaggtgtgt
ccgatgctgaagcctcagacccagggcctggcccgcgacgcctgggagatatcccgggag
tccctccacctcgacctcaaactgggccagggctgcttcggagaggtctggatggggaca
tggaatggtacaacgcgggtggccatcaagaccctgaagacgggtaccatgtccccagag
gccttcctccaggaagcccaggtcatgaagaagctgagacacgagaaactggtgcagctc
tacgccgtggtgtctgaggaacccatctacatcgtcaccgagtacatgagccaaggtagc
ctgttggacttcctgaaaggtgacacgggcaagctgctacgtctaccccagttagtggat
atggcatctcagattgcagcagggatggcatacgtagagagaatgaactacgtccacaga
gacctcagggctgccaacatcctggtcggggacaacctggcatgtaaagtggccgacttc
ggtttggcccgcctcatagaggacaacgagtacactgctagacagggtgccaagttcccc
attaagtggaccgcgccagaggctgcactctacggacgcttcaccatcaagtcagatgtc
tggtcattcggggtcctgctcactgaactggccactaaaggcagagtcccatatccaggc
atggtgaaccgggaggtgttggatcaggtggagcgtggctaccggatgccctgccctgct
gagtgcccagcctccatgcacgagctcatgctcacctgctggaggaaggacgcagaggag
cggcccaccttcgagtacctgcagggcttcctggaggactacttcacctccactgagccc
cagtaccagcctggggagaacctataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267038
Entry
112267038         CDS       T05605                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04144  Endocytosis
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112267038
   04370 VEGF signaling pathway
    112267038
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112267038
   04137 Mitophagy - animal
    112267038
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112267038
   04520 Adherens junction
    112267038
   04530 Tight junction
    112267038
   04540 Gap junction
    112267038
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112267038
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112267038
  09152 Endocrine system
   04912 GnRH signaling pathway
    112267038
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112267038
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112267038
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112267038
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112267038
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  SRC family
   112267038
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112267038
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    112267038
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112267038
  Macropinocytosis
   Kinases
    112267038
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 112267038
NCBI-ProteinID: XP_024300816
LinkDB
Position
2
AA seq 547 aa
MGVGKSKPKEPGQRSLSLDGTIGTGLDSMHHHLSPAQQTQTPNRSPAVGVTRRAHHPGHA
PTNTPELALFGGVDHTGSIISPHRGLLAGGVTTFVALYDYESRTASDLTFKKGERLQIVN
NTRKYSFREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRNSERLLLSLQ
NRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQL
VFHYRKHADGLCHCLTEVCPVLKPQTQGLARDAWEIPRESLHLDLKLGQGCFGEVWMGKW
NGTTRVAIKTLKTGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMTQGSL
LDFLKGDTGKLLRLPQLVDMASQIAAGMAYVERMNYVHRDLRAANILVGDNLVCKVADFG
LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGM
VNREVLEQVERGYRMPCPGECPSSMHELMLICWRKDAEERPTFEYLQGFLEDYFTSTEPQ
YQPGENL
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgggagtcggcaagagcaagcctaaggagccgggtcagcgctcactgagtctggatgga
accattggaacaggcttggacagcatgcaccaccacctcagcccagcccagcagactcag
acccccaacagaagtcccgccgtaggggtcacgaggcgcgcccaccaccccgggcatgcc
cccaccaacacccctgagctggcactgttcggcggggtggaccacacgggcagcatcatc
tctcctcacagaggactactggcaggaggtgtcactacatttgtggcgctctacgactat
gagtcacggactgcctcggacctgacgttcaagaaaggcgagcggctgcagatcgtcaac
aacacgagaaagtacagcttcagggaaggggactggtggctcgctcggtctctgaccacc
ggagaaagcggttatatccccagcaactacgtggccccctctgactccatccaggcagaa
gagtggtattttgggaagataactcggcgcaactcggagaggctccttctgagtttacag
aaccgacgaggaaccttcctggtccgagagagcgaaaccactaaaggagcctattgcctg
tccgtgttggactatgacaacactaaaggcctcaacgtcaaacactacaagatacgcaaa
ctagacagcggcggtttctatatcacctcacgcacccagttcagcagtctgcagcagctg
gtcttccactatcgcaagcatgcagacgggctgtgccactgtctgacggaggtgtgtccc
gtgctgaagcctcagacccagggcctggcccgtgatgcctgggaaatcccacgggaatcg
ctccacctcgacctcaaactgggccagggctgttttggagaggtctggatggggaagtgg
aacggtacaacgcgggtggccatcaagaccctgaagacaggcaccatgtccccagaggcc
ttcctccaggaggcgcaggtcatgaagaagctgagacacgagaaactggtgcagctctac
gctgtggtgtctgaggaacccatctacatcgtcactgagtacatgacccaaggtagcctg
ttggacttcctcaaaggtgacacgggcaagctgctacgtctaccccagctagtggatatg
gcatctcagattgcagcagggatggcatacgtagagaggatgaactacgtccacagagac
ctcagggctgccaacatcctcgtaggagacaacctggtgtgtaaagtggccgacttcggc
ctggcccgcctcatagaggacaacgagtacactgccagacaaggagccaagttccccatt
aagtggacggcgccagaggctgccctctacggccgcttcaccatcaagtcagatgtctgg
tcatttggggtcctgctcactgaactcgccaccaaaggcagagtaccatatccaggcatg
gtgaaccgggaggtgctggagcaggtggaacgcggataccggatgccctgtcccggcgag
tgcccgagctcaatgcacgagctcatgctcatctgctggaggaaggatgccgaggagagg
cccaccttcgagtacctccagggcttcctggaagattactttacctccaccgagccccag
taccagcctggggagaacctatag

DBGET integrated database retrieval system