KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216339
Entry
112216339         CDS       T05605                                 

Definition
(RefSeq) arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2-like
  KO
K17848  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112216339
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112216339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112216339
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112216339
Membrane trafficking [BR:otw04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    112216339
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   112216339
SSDB
Motif
Pfam: ArfGap Ras PH Ank_2 Ank_5 Ank_4 PH_6 PH_8 PH_4
Other DBs
NCBI-GeneID: 112216339
NCBI-ProteinID: XP_024232017
LinkDB
Position
16
AA seq 818 aa
MNSSNKLSQSSAIRAEVKRHESVQNTINKLFKQFERVGDQQLRSGLKVYLHSIQAACANS
QEWTLSRSIPELRVGVLGSLRSGRSALINRYITGSYLPLEKIEGGRYKKEVLVDGQSHLL
LIREEAVTPDAQFSNWVDAVVLVFSLENEASFQDVYQLYSQLNTHRSRADIPLVVVGTQD
KISSTNPRVIEDMRARQLCVDVRHCVFYETCATYGLNVDRVFQEAAQKIVTQKKQSAFLA
SCKSLPNSPSHSGGSTSGSASFPGQASNGGLNSGYPSSLPSTPVISHRELRGGAGAVAAV
EGGGSITSSGSMRNIPQRRTSLFKNRRGSGSEKNVDPKGDVGSGRAIAIKQSILSKRSGS
SLNKEWKKKYVTLSNNGSLVYHPSHNDYIQNSHAKEIDLLRVTVKVPGKRPPRAVPPYGP
SPGLNGVAKDAAPTESASASLSPPSLVPVEEQPGALSSPRDRGVKRCPSTLSSKSHSADA
IEGATSPPFGKDGQSSPMMDKRKKTRKKSMNQKGDTAIGQAEDEENTGFIIVSSTGQTWH
FEAQSLEDRDAWVTAIESQILASLQSCESLRNKARRSSQSEAVAIQAIRNAKGNSFCVDC
EAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTQVLTAIGNHLANS
IWECHTQGRHKPTPNATREERESWIRAKYEQRVFVAPLPAPSPTGPGDTAMSVCLLSAVT
ERDLPRLLLLLAHSNKEQINTALANGGTPSQPQPHTSLHAACQLGDVVMTQLLVWYGSDV
KARDPQGQTAMTMARKSGSKECADILLQHGCPNEVSPN
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgaatagcagcaataaattgtctcagtcaagtgccataagagcagaggtaaaacggcat
gaatctgttcagaacacaatcaacaaactgtttaagcagtttgagagggttggtgatcag
cagctccgctctggccttaaggtttacctccacagtattcaagcggcttgtgcaaatagt
caagagtggaccctgagtcgatccatccctgagctccgtgtgggggtgctgggaagtctt
cggagtggcaggtcagcgctgataaacagatacataacaggcagttaccttccactagag
aagattgaaggggggaggtataagaaggaggtattggtagatggacagagtcatctattg
ctaatcagagaggaggcagttactcctgatgcacagttcagcaactgggtagatgcagtg
gtccttgtgttcagtctggagaatgaggccagcttccaggatgtataccagctgtacagc
cagctcaacacacaccgcagccgtgctgacatcccacttgttgtggttgggacacaagac
aaaatcagcagtaccaacccacgtgtgattgaggacatgcgtgcccggcagctatgtgtt
gatgtgaggcactgtgtgttctatgagacctgtgccacctatgggctcaacgtagaccgg
gtttttcaggaggctgcccagaaaatagtcacacagaagaaacagtctgcgttcctggcc
tcctgcaagtctcttcctaactcccccagtcactctgggggctccacatcggggtcagca
tccttccctggacaggccagtaatggaggactgaatagtggctacccctcctccctaccc
tccacccctgtgatcagccacagagagctgcggggcggggcaggggcggtggcagcggta
gaggggggtggcagtatcacctcctcagggtccatgagaaacatccctcaacggcggacc
tctctgttcaagaaccgtcgaggcagtggcagtgaaaagaatgttgaccctaaaggtgac
gtgggcagtggccgggccatcgctatcaaacagagtatcctgtcaaagcggagtgggagc
tcactgaacaaagagtggaagaagaaatatgtcactctgtccaacaacggctcactagtc
tatcaccccagccacaatgactatatacagaattctcacgctaaagagatcgacctactg
cgtgtcacagtgaaggttccagggaaacgcccaccaagggcagtccccccttatgggccc
tcccctggcctgaacggtgtggccaaggatgctgcacccacagagagcgccagtgcctca
ttgtcaccaccaagccttgtgcctgttgaagaacagccaggtgcattgtcttctcccaga
gatagaggagtaaaacgttgtccatcaacactgtccagcaagtcacatagtgctgatgct
attgaaggagcaaccagtcccccttttggaaaagatggtcaatcctctccaatgatggac
aaaaggaagaaaacaaggaagaagagtatgaaccagaaaggcgacacagctattggacag
gctgaagatgaggagaatactggcttcatcatcgtgtccagcacggggcagacgtggcac
tttgaggcccagagtctggaggacagagatgcctgggtgacggccatagagagccagata
ctggccagcctgcaatcctgtgagagcctcaggaacaaggcacggaggagcagccagagt
gaggcggtggccatacaggccattcgcaatgccaagggcaacagcttctgtgtggactgt
gaagcaccaaaccccacgtgggccagcctcaacctgggggcgttgatctgcatcgagtgt
tcagggatccaccgtaatcttgggacacacctgtcccgcgtccgctctctggacctggat
gactggcccagggagctgacacaggtcctgactgccattggcaaccacttggccaatagc
atctgggaatgccacacccagggcagacacaaacccacacccaacgccacacgagaggag
agagaatcatggatccgtgcaaaatacgagcagcgtgtgtttgtggcacccctgcctgct
ccaagccccacaggcccaggggacactgcgatgtctgtgtgtctgctctccgcggtgaca
gagagggatttgcccaggctcctactgctcctggcccacagcaacaaggagcagatcaac
actgccctggccaacggaggaacaccctcacagccacagcctcacacctccctgcacgct
gcctgtcagctgggtgatgtcgtaatgacacagctgctagtctggtatggaagtgatgtg
aaggccagggatcctcagggccagacagccatgaccatggctagaaaatctgggagcaaa
gagtgtgctgacatcctcctgcaacatggctgccctaatgaggtctcacctaattga

DBGET integrated database retrieval system