KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216753
Entry
112216753         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112216753
   04068 FoxO signaling pathway
    112216753
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112216753
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 112216753
NCBI-ProteinID: XP_024232570
LinkDB
Position
17
AA seq 186 aa
MCNNMSNVSLSNGSPKLERVDPRPTDHTKPQICRNLFGSVDHDELGRECLVQMKEMEKVF
IDKWNFDFLNDEPLPQGDYNWEPMKSSDMPDFYSRPSHKRVWSSGNVDHNGNHGVRPSCP
ANGAELSEKSERQTDCHHSHNGARKRHANPEPQSTSKKLHSSEEDEVVSKSVEQTPSKND
SRTHEH
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcaaatgggagtccgaagttggaaagggtg
gatccgcgcccgacggatcacacgaagccccagatttgcagaaatcttttcggatcggtg
gatcatgacgaattagggagggagtgtttggttcaaatgaaagagatggagaaggttttt
attgacaaatggaattttgattttctaaacgacgagccccttccccagggagattataat
tgggaaccgatgaaaagcagtgacatgccagacttttacagcagaccgtctcataagcga
gtctggtcctctggaaatgtggaccataacgggaatcatggagtccgaccgagctgtcct
gcgaacggggctgagctatccgagaagagcgagaggcagacggattgtcaccactctcac
aacggggcaaggaaaagacatgcaaatccagagccccaaagtacaagtaaaaagttgcat
tccagtgaagaggatgaagttgtgtcaaagtcagtagagcagacacccagcaaaaacgat
tccaggacacatgaacactaa

DBGET integrated database retrieval system