KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216793Help
Entry
112216793         CDS       T05605                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04910  Insulin signaling pathway
Module
otw_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    112216793 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112216793 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:otw01003]
    112216793 (gys2)
Enzymes [BR:otw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     112216793 (gys2)
Glycosyltransferases [BR:otw01003]
 Polysaccharide
  Storage polysaccharide
   112216793 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 112216793
NCBI-ProteinID: XP_024232633
LinkDB All DBs
Position
17
AA seq 764 aa AA seqDB search
MPLTRSLSMTSLSGLPLWDEEDLPVDDLLLFEIAWEVTNKVGGIYTVIQTKAKITVDEWG
ENLFMMGPYYEHNFNTQVEQCEPPNPAIKKAMGALIDNGCLVYFGRWLIEGSPYVILFDT
GSAAWNLDRWKGDLWDTCGIGLPAHDREANDSLLFGSMVAWFFKELTDELGDSPNVLAHF
HEWQVGAGLILCRSRKIPLATIFTTHATLLGRYICAGNVDFYNNLDKFNIDQEAGERQIY
HRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHST
NKGQIQEFIRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLESLSRLNYLLRVHKND
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKDKFGKRLYEALLKGDIPDMNTI
LDRDDFTIMKRAIYATQRHTLPPVTTHNMLDDTSDPILANVRRIGLFNARTDRVKIVFHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFME
EHVSDPTAYGIYIVDRRFRSADDSCNQLTQFMFGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRFYMHARSLALSRAFPDKFKMEPLAPPQVRQRDSVTPAPALCPPPPRRRCTPPPTTV
MRRMMKSRMMKIRRQRGTGRTSKPHSLWVPRPRARRHTQESLPTERSLATSLGWPSLGWP
TLVLESCSMWRFLFQPRTYNISSVLSSCYTYYLCIFSKRKCLFF
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgacccgttccttgtccatgacgtcactgagcggtctgcctctgtgggatgag
gaagatctacctgtagacgacctgctgctgtttgagattgcctgggaggtcactaataaa
gtgggtgggatctacacagttatccagaccaaggccaagataacagtggatgaatggggg
gagaacttattcatgatggggccgtactacgaacacaactttaacacccaggtggagcag
tgtgagccccccaacccagccatcaagaaagccatgggcgccctcattgacaacggttgc
ctggtgtactttgggcgctggctgattgagggcagtccctatgtgatcctatttgacacg
gggtcagcagcctggaacctggaccgatggaagggggatctgtgggacacctgtggtatt
ggcctgcccgcccatgacagagaggccaacgactcactcctctttggatccatggttgcc
tggttctttaaagagttaaccgacgagcttggagactcgcccaatgtcctcgcccatttc
catgagtggcaggtcggggcaggacttattctctgtcgctcacggaagattcccttggca
accattttcacaacccatgccactctgttgggaagatacatctgtgccggaaatgttgac
ttctacaacaacctggacaagttcaacatagaccaagaggctggtgagaggcagatctac
catcgctactgcctggagagagctgctgtccactgtgcccatgtctttacaactgtatcc
cagatcactgctgtagaggctaaccacatgctgcacaggaaaccagatgtggtgactcca
aacggattgaacatcaagaaattctcagccatgcacgagttccagaaccttcactccact
aataagggtcagattcaggaattcatcaggggacacttctatggtcatctggacttcaat
ctggagaaaactctcttcttctttattgctggacgatatgagttctccaacaagggagtt
gacatcttcctggagtcactgtccaggctcaactatctgctaagggtgcataagaacgac
gtcacagtggtggtgttcttcatcatgccagccaagaccaacaattttaacgtggagacg
ctgaagggtcaggcggtgcgcaaacagctctgggacactgctcacactgtgaaagataag
tttggcaagaggctttatgaggcgttgttaaaaggagacatccctgatatgaacaccatc
ctggacagagacgacttcaccatcatgaagagagccatctatgccacacagagacacacc
cttcctccagtgaccactcacaacatgctggatgacacctccgaccccatcctggccaac
gtgagacgcatcggcctcttcaacgctcgcactgaccgagtcaagatagtgttccaccca
gagttcctgtcgtccaccagtcccctgcttcctatggactatgaggagtttgtacgaggc
tgtcacctgggggtcttcccttcttactacgagccctggggatacacaccaggtgagtgt
actgtgatggggatacccagtgtgaccaccaacctgtctggcttcggctgcttcatggag
gaacatgtgtcagaccccacagcatacgggatctacatagtggaccggcggttccgttcg
gcagatgactcgtgtaaccagctgacccagttcatgttcgggttctgccagcagtccaga
cgacagcgcatcatccagaggaaccgcacagagagactgtcggacctgctggactggagg
tacctgggacggttctacatgcacgcccggagcctggctctcagcagggctttccctgac
aagttcaagatggagccgctggccccgccacaggtgagacagagggattccgttaccccc
gccccggctctgtgcccccctccccctcggcgtcggtgcactccaccccccaccacagtg
atgaggaggatgatgaagagccgtatgatgaagataaggaggcagagagggacaggcaga
acatcaaagccccattcactctgggtgccacgcccgagggcaagaagacacacccaggag
agtctgccgactgagagatctctcgctacgagcctgggatggccgagcctgggatggcca
accctggtccttgagagctgtagtatgtggaggtttttgttccagcccagaacgtacaac
attagctctgtcttaagtagctgttacacatactacctatgtatattttctaagagaaaa
tgcctattcttttga

DBGET integrated database retrieval system