KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217028
Entry
112217028         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112217028 isoform X1
  KO
K05461  KIT ligand
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217028
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112217028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112217028
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112217028
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 112217028
NCBI-ProteinID: XP_024233017
LinkDB
Position
17
AA seq 247 aa
MCFLCQIRTTTCVLLFLFTSLGVCSGGFGNPVTDDVSRLILLKHNIPKDYNISIHYIPKE
RSGVCCVLLNIYPLEQSLRELARVFGAISSNKDNIMIFITMLQNLRFQFDHEELEATMQV
FKCHYRAVKWPSGQYFDYIRDILNSAAQGEGGFRCVPPPCPAPTTPGSEAQDHEQTRSRG
SLLSLLPIPVTACVFLIVWMIQSRREGSPESNPERGHRRLSTNVERTINILIPPVTSTTD
TPIMGEA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtgcttcctctgtcagattcggacaactacgtgtgtactcctatttctattcacaagt
cttggagtatgctcaggaggatttgggaatcctgtaacagatgatgtgagcaggctgatc
ttattgaaacacaatattccaaaggattataacatttctatacattatattcccaaagag
aggagtggtgtgtgctgcgttctattgaatatctatccactggaacaaagccttagggaa
ctggcccgagtgtttggtgccatttcttccaacaaagataatattatgatcttcatcacc
atgctgcaaaatctacgtttccaatttgatcatgaggagctggaggcaacaatgcaagtc
tttaaatgccactatagggcggtcaaatggccatctgggcagtattttgactatatcaga
gatattttgaattctgcagctcagggagaaggaggattccgctgtgtgcctccaccctgc
cctgcccctactacaccaggaagtgaagcacaggatcatgaacagactcggtcaaggggg
agtctgctgtccctgcttccgatcccagtcacagcctgcgtgttcctcattgtgtggatg
attcaatctagaagagaaggctccccagagagtaacccagagagaggccatagaaggctg
tccactaatgtggaacggaccataaacatccttattccaccagtcaccagtacaactgac
acaccaataatgggggaagcctga

DBGET integrated database retrieval system