KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217395
Entry
112217395         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 2-like
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112217395
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217395
   04530 Tight junction
    112217395
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112217395
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112217395
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112217395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112217395
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112217395
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112217395
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112217395
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112217395
SSDB
Motif
Pfam: Rho_Binding PH C1_1 Pkinase_C DUF4983 Filament
Other DBs
NCBI-GeneID: 112217395
NCBI-ProteinID: XP_024233409
LinkDB
Position
18
AA seq 1089 aa
MYREVHLGRNGVEEIKRHPFFRNDQWTFHTIRQTVAPVVPELSSDIDTSNFDEIKDDKGD
VETFPTPRAFVGNQLPFVGFTYFKEDQLLRGGNTGISVEDSKDCKDSSEEKVDSIKGELQ
NKLRCLEEQLNHEMQAKDDLEHKCKTTTSRLEKLVKEIDEEMNSRQRVESSLRQLERERA
LLQHQSAENLCKVEMEAGRKRSLENELNGLRDQLEELKRRNQKSQLSNEKNIHLQRQLEE
ATAVLAEEQEAAGRLRRSQSEAQKQAQALEFNLRELVDNCTQLENAKMGLEQQLMGLQAD
LEAERRDRSLGTEIILDLQGHIQVLEAEVKHVKGSLSNSQMEKRQLQHRLTDMEKEKSNQ
EIDLAFKLKSLQQSFDAERAEHKVTKTRLADKNQIYESIEEAKSEALKGMERTLQEERSH
KLQLASRLLLLEKEHSMLDCDYKQAEHKLDELRTHKDKLAEEVKNLSLCMEQEEKKRMLS
QNDLNVQTQQVTALCSSEKQLKQELNHLLDMKHSLEKQNQELRGERQETDGQLKEMKDQL
EAEQYFTTLYKTQIRELKEECDERNKLYKDILQRLEEYQEERDSLAAQLGVSLTKVDSEQ
LARSIAEEQYSDLEKEKIMKELEIKDMMARHRQELGDKEATIGSLEESNRTLTVDVANLA
NEKEELNNQLKEMQQQLQKAREEERHMNSVKMSFEKNLQTERTLKIQAVNKLSEIMNRRE
TMRAGHRHDDTLDMRRKEKENRKLQLELRSEKEKLNSTIIKYQREINDMQAVLSDESQVR
MELQMALDSKDSDIEQLRCQLTSLSIHSMDSTSISSSNDMDDSGYPDTRLEGWLSLPVKN
TKRFGWDRRYVVVSSKKILFYNSDMDREQSNPYMILDIDKLFHVRPVTQTDVYRADTKEI
PRIFQILYANEGESKREQEFAVEPLALAGERSSYVKHKGHEFIPTLYHLPSSCEACTRPL
WNVFKPPPALECRRCHTKCHKDHLDRNEEAIAPCRVNYDISTAKDLLLLAGSQEEQQRWV
SRLIRRIPRKHPGPASVAQAPEPASHSSPRLSPGASPRNSPSLSSHRGAIKVQPSRQQTQ
PAGKPSLPL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atgtacagggaggtgcatctggggaggaacggcgtggaggagatcaagagacaccccttc
ttcaggaatgaccagtggaccttccacaccatccgacagaccgtggccccagttgtacca
gagctgagcagtgacatagacaccagtaactttgacgagattaaggatgacaaaggcgac
gtggagacctttcccacaccaagggcctttgtgggcaaccagctgccattcgtgggcttc
acctacttcaaggaagaccagcttctgagaggtgggaatacagggatatctgtggaggac
tctaaagactgtaaggatagctctgaggaaaaagtggacagcattaaaggagagctacaa
aataaactccgttgtctggaggagcagctcaaccatgagatgcaggccaaagacgacctc
gagcacaagtgcaagactaccactagccgtctagagaagctggtcaaagagatcgacgag
gagatgaacagcaggcagagagtggagtcatcgctgaggcagctggagagagagagggcc
ctgctgcagcaccagagtgctgagaacctctgcaaggtggagatggaggcaggcaggaaa
cgcagcctcgagaatgagctaaacggcctgcgggaccagcttgaagagctgaagaggagg
aaccagaagtctcagctctccaacgagaagaacattcacctgcagagacagctggaggag
gcgacagcggtgctggccgaggagcaggaggcggcggggcggctgcggaggagccagtca
gaggcccagaagcaggcccaggccctggagttcaacctcagggagctggtggacaactgc
acccagctggagaacgccaagatgggcctggagcagcagcttatgggtctgcaggccgac
ctggaggccgagaggcgggaccgcagcctagggacagagattatactggacctgcagggg
catatccaggttctggaggcggaggtgaagcatgtgaagggttctctctccaattcacag
atggagaagaggcagctacagcataggctcactgacatggaaaaggagaagagcaaccag
gagattgacctggcattcaagctcaagtcactgcagcagagctttgacgcggagcgggca
gagcacaaggtcaccaagacccgcctagctgacaagaaccagatctacgagtccatcgaa
gaagccaagtctgaggccctgaaagggatggagcggacgctgcaggaggagcggagccac
aagctgcagttggcgtccaggctgctgctcctggagaaggagcactccatgctggactgt
gactacaagcaggctgagcacaaactggacgagctgcgcacgcacaaggacaaactcgct
gaggaggtgaagaacctgagcctgtgtatggagcaggaggagaaaaagcgcatgctgagc
cagaacgacctgaatgtccagacccagcaggtgactgctctgtgctcctcggagaagcag
ctgaagcaggagctcaaccacctgctagacatgaagcacagcctggagaaacagaaccag
gagctacgcggggagagacaggagactgacggacagctgaaggagatgaaggaccagctg
gaggctgaacagtatttcacgaccctgtacaagacccagatccgggagctgaaggaggag
tgtgatgagaggaacaagctgtataaggacattctgcagagactggaggagtaccaggag
gaaagggattccctggcagcacagctgggggtgagcctaaccaaggtggactctgaacag
ctggcgcgctccatcgcagaggagcagtactccgatctggagaaggagaagatcatgaag
gagctggagatcaaggacatgatggcccgacacaggcaggagctaggggacaaggaggcc
accatcggctcgttggaggagtccaaccgcaccctgackgtggacgtggccaacctggcc
aatgagaaagaggagctcaataaccaactgaaggagatgcagcaacagctccagaaggcc
agggaggaggagagacatatgaacagtgtgaagatgtccttcgagaagaatctgcagacg
gagagaacacttaagatacaggcggtcaacaagctgtctgaaatcatgaaccggagggag
acgatgcgtgcgggtcaccgccacgatgacaccctggacatgcgcaggaaggagaaggag
aacaggaagctacagctggagctgagatcggagaaggagaaactcaacagcaccatcata
aagtaccaaagagagataaacgatatgcaggcggtgttatcagacgagagccaggtgcgc
atggagctccagatggccttggacagtaaggacagtgacattgagcagctgcgctgtcag
ctgacctctcttagcatccactctatggactccaccagcatcagcagcagtaacgacatg
gacgacagcggttacccagataccaggctggagggctggctatcacttcctgtgaagaac
accaagagatttggatgggatagaaggtacgtggtggtaagcagtaagaagatcttgttc
tacaatagtgatatggaccgagagcagtccaacccctacatgatcctagacattgataag
ctgttccacgtccgaccagtcactcaaacagacgtgtaccgtgctgacaccaaagaaatc
cccaggatattccagatcctttacgccaatgagggcgagagcaagcgggagcaggagttt
gcggtggagccgctggcgctggcgggcgagcgctcgtcctacgttaagcacaagggtcac
gaatttatccccactctctaccacctgccgtcgagctgtgaggcatgcacgcggcccctg
tggaacgtgttcaagccgccacccgcgctggagtgccgccgctgccacaccaagtgccac
aaggaccacttagaccggaatgaggaggccattgccccctgcagggtgaactacgacata
tccacggccaaagacctactcctattggccggctctcaggaggagcagcagcgatgggtc
agccggctaatcagacgcatcccgaggaaacaccctggacccgcctccgtggcccaagcc
cccgagccagcctcccactcctccccccgactctcccctggcgcctccccccgcaactct
ccaagcctgtcctcccaccgcggagccatcaaggtccagcccagtcgccagcagactcag
cctgcagggaagcccagcttacctctataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226775
Entry
112226775         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 1-like isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112226775
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226775
   04530 Tight junction
    112226775
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226775
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112226775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226775
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112226775
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112226775
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112226775
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112226775
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 HR1 Cortex-I_coil APH Pkinase_C
Other DBs
NCBI-GeneID: 112226775
NCBI-ProteinID: XP_024247083
LinkDB
Position
28
AA seq 1385 aa
MSAGESLEARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSAWVVQLFYAFQDDRCLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHAMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
DDSDISKDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRDTAAPVVPELS
SDIDTSNFDDIEADRGDEETFPIPKAFVGNQLPFVGFTYYSSHQFSRSSSTKSVDKRSSS
TKEDKSHLENLQKRIYQLEEQLHSEMQLKDEMEQKCRASNTKLDKIMKELDEEGNVRKGV
EASMSLLEKDKMMIQHRATEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKICQNSQASN
DKILQLQNQLEEANDLLRAESDTAARLRKSHTEMAKSMSQLEGLNRELQEKCRSSEGGRA
QLEKELLQLQSTLDSERRCYSQGSEEIHELQVRTTGLQEDNKNLKLCLSKVEAERKQAQE
RRNNLEKEKNNLEIDLNYKLKTLQQRLDQEHTEHRVTRAQLTDKYESIEEAKSAAMHAVQ
QKVSEESGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKGLRMQLE
QESSKRLLAQNELKSRSQEADRLKGSEKQLKQEINAALESKRSLEFQLAQLTKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEDIEERNRQVQEVQKKVQELHSERDSLLAQLDL
TVTKAESEQLARALQEEQYFELSQENKKTTARHKQEGTEKDATIARLEDSNKTLTKDVEN
LSKEKAELNNKLCIQEEEYASQKEEITNAIKANYEKVLSTERTLKTQAVNKLAEIMNRKD
MKLDTKKKGNTTDLRKKEKENRKLQLELKQEKDKFNHMAIKYQKELSEMQAQLSEECTYR
NELQMQLDSKESDIEQLRERLNDLQLRMDNSSVTSLQMDETDSNIAESRLEGWLSIPNKP
NIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEE
IPRIFQILYANEGECRKEADMETVSQGDKTNCLPHKGHEFIPTLYHFPTNCEACAKPLWN
VFKPPPALECRRCHVKCHQDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWIGH
LGKKIPKTPPSSFLRASPRTMSTRPAPNQSFRKNPKSITGKPRSQSHSATTASSLQAADA
TSSTC
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgtcggctggagaaagtttggaagctcgttttgagaaaatcgatgccatgttgaaggac
ccgaagtcggaaataaacacggattgccttttggatggcttggatgcgttggtgtacgac
cttgactttccagccttgaggaaaaacaaaagcatcgacaactttttgaatagatataag
gacaccatcagtaagatccgggacctgcggatgaaagcagaggactatgaggtggtcaag
gttatcgggaggggtgcttttggagaagtgcagttggtaagacacaaagccaccaggaag
gtgtacgccatgaagctgcttagcaagtttgaaatgatcaaaaggtcggactctgctttc
ttctgggaggagagggacatcatggcctttgccaacagcgcctgggttgtgcagctgttt
tatgcattccaggatgaccgttgcctctacatggtgatggagtatatgcccggcggagac
ctggtcaacttgatgagcaactatgacgtccccgagaagtgggcccgtttctacaccgct
gaggtggtgctggctctggacgggatccacgccatgggcttcatacacagggacgtgaag
cctgataacatgttgctagacaaagcgggccacttgaagttggcagactttgggacctgt
atgaaaatgaacaaggatggtatggtacgatgcgacaccgcagtgggaacaccagactac
atttcgccagaggtactaaaatcccagggaggagatggatattacggccgggaatgtgac
tggtggtccgtgggagtcttcctgtacgaaatgctcgttggtgacacaccgttctatgct
gactcgttggtggggacgtacagtaagatcatgaaccacaagaatgccctgaccttccct
gatgacagcgacatctccaaggatgccaagaaccttatctgtgccttcctgactgacagg
gaggtaagactgggtcgcaacggggtggatgagatcaagagacatcctttcttcaagaac
gaccagtggacatgggagaacatccgagacacagcggccccggtggtgcctgagctgagc
agcgacatcgacaccagtaactttgacgacatcgaggcggaccggggagacgaggagacc
ttccccataccaaaggccttcgtgggcaaccagctgccctttgtgggcttcacctactac
agcagtcatcagttttcccggagctccagcaccaagagtgttgacaaacgcagcagctcc
accaaggaagacaagagccatctggagaacctgcagaagaggatctaccagctagaagaa
caactccacagtgagatgcagctgaaggacgaaatggagcagaagtgcagggcctcgaac
acaaagcttgacaagatcatgaaagagctggacgaggagggcaacgtgaggaagggtgtg
gaggccagcatgtccctgctggagaaagacaagatgatgatccagcaccgagccaccgag
taccaaagaaaggccgaccaggaggccgagaagagacgcaacttggagaacgaggtgtcc
actctgaaggagcagcttgaggacatgaggaaaatctgccaaaactctcaggcctcgaat
gacaagatcctacagttacaaaatcagctggaggaggccaatgacctgctgcgggcagag
tcggacacggcggcgcggctgaggaagagccacacggagatggccaagtccatgagccag
ctggaggggctgaaccgcgagctgcaggagaagtgtcgttcgtctgagggggggagggcc
cagctggagaaggagctgctgcagctgcagagcacgcttgactctgaaaggaggtgctac
agccagggatcagaggagatccacgagctgcaagtgcggacgactggtcttcaggaggac
aataagaacttgaaactctgcttgtccaaagtggaggcggaacgcaaacaggcccaggag
aggagaaacaacctggagaaggagaagaacaacctggagattgacctgaactacaagctg
aagactctgcagcagcgtttggaccaggagcacacggaacacagagtgacgcgggcccag
ctcactgacaaatacgagtccattgaagaggccaagtcagctgccatgcatgcggtgcag
cagaaggtgtcggaggagagcggggcgaggatgcgagcggagagcagggtggtggaggtg
gagaagcagtgctccatgctggagtttgaccttaagcagtcagtgcagaagatggagcag
ctgatgaagcagaaggagaggctggaggacgaggtgaaaggtctacggatgcagctggag
caggagtccagtaagaggctgctggcccagaacgagctgaagagccgctcgcaggaggcc
gaccggctgaagggctcagagaagcagctgaagcaggagatcaacgcggcactagagagc
aaacggtcgctcgagttccagctcgcacagctcaccaagcagtacaggggcaacgaggga
cagatgagggaacttcaggaccagcttgaggccgaacagtatttctcaacgctttataaa
actcaggtgaaggaactgaaagaggatattgaggagaggaaccggcaggtccaggaagtt
caaaagaaggtgcaggagctgcacagcgaaagggactccctgttggcccagctggatctg
acagtgaccaaggcggagtcggagcagctggccagggcgctccaggaggagcaatacttt
gagctgagccaggagaacaagaagaccacggccagacacaagcaggagggcaccgagaag
gatgccaccatcgcacggcttgaggattccaacaaaactctgaccaaagatgtggagaac
ctcagcaaggagaaggccgagctgaacaacaagctttgcattcaggaggaagagtatgcc
tcccagaaagaggagattacaaacgcaatcaaggccaactacgagaaggttctcagcaca
gagcgcacgctcaagactcaggcggtgaacaagctggcagagatcatgaacaggaaggat
atgaagctggacaccaagaagaagggcaacacgaccgacctgaggaagaaggagaaggag
aaccgcaagctgcagcttgagctcaaacaggagaaggacaagttcaaccacatggccatt
aagtaccagaaggagctcagtgagatgcaggcgcaactgtccgaggagtgcacgtaccgc
aacgagctgcagatgcagctggacagcaaggagagtgacatcgagcagctgagggagagg
ctcaacgacctgcagctgcgcatggacaactccagcgtcaccagcctgcagatggacgag
acggacagcaacatcgccgaatccagactggaagggtggctgtccattcctaataaacct
aatatcaaacgatatggctggaagaagcagtatgtggtggtgagcagcaagaagattctg
ttctacaatgatgaacaggacaaagaacagtccaacccctccatggtactagatatcgac
aaactgttccacgtgcgtccagtcacccagggtgatgtgtaccgtgcagagaccgaggag
atcccaaggatattccagatcctgtatgccaatgagggggagtgcaggaaggaggcggac
atggagacggtctcgcagggcgacaagaccaactgcctgccccacaaaggtcatgagttc
atccccacgctttaccacttccccacgaactgcgaggcctgcgccaagcccctgtggaac
gtcttcaagcccccacctgccctggagtgccgccgctgccatgtcaagtgccaccaggac
cacctcgacaagaaggaggacgtcattgccccctgcaaagtgaactacgacgtgacctct
gcccgggacatgctcctgctagctctgacccaagacgagcagaagaaatggattggccac
ctgggcaagaagatccccaaaacaccgccctcctccttcctgagggcgtcgcctcgcacc
atgtccacccgccccgcacccaaccagtccttccgcaagaaccccaaaagcatcacaggc
aagccaaggtcgcagtctcattctgctaccacagcctccagcctccaagcagcagacgca
acatccagcacttgttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232894
Entry
112232894         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 2-like isoform X1
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112232894
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232894
   04530 Tight junction
    112232894
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232894
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112232894
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112232894
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112232894
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112232894
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112232894
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112232894
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil Pkinase_C
Other DBs
NCBI-GeneID: 112232894
NCBI-ProteinID: XP_024255939
LinkDB
Position
Unknown
AA seq 1405 aa
MSLGAERRMENRLKKLEAMIKDPRSAINLESLLDSINAFVLDLDYPALRKNKNIETFLNR
YEKVMGHIRDFQMRSEDFDRVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAFANSPWVVQLCCAFQDDRYLYMVMEYMPGGDLVNLTSTYDVPEKWARFY
TAEVVMALDAIHSLGFIHRDVKPDNMLLDRHGHLKLADFGTCMKMDSTGMVHCDTAVGTP
DYISPEVLKSQGGDGYYGRECDWWSVGVFIFEMLVGDTPFYADSLVGTYSKIMDHKNSLN
FPDDVEISKDAKNLICAFLTDREVRLGRNGVEEIKRHPFFKNDQWNFDSIRNTAAPVVPE
LSSDIDTSNFDEIEDDKGDVETFPTPKAFVGNQLPFVGFTYFKEDQLLSGVNNSTVVTVN
STALKGEDIVMSAKLQKKLHQLEEQLNNEMQTKDELEHKCRTATSRLEKTSKDLDEEVSS
RKALESSLRQLEREKALLQHKTVESHRKAESEADRKRCLENEVNSLRDQLDEMKKRNQNS
HISNEKNIHLQRQLDEANALLRAEQEVATRLRKAQTETGKQLQALEAGGRELQDKCCLLE
RSKLTLEKEFIGLQAALEAERREHSQGSETITDMQGRISGLENEVWQVRQALSKAETEKR
QLQEKLTALEKEKNNKEIDMTYKLKVLQQGLEQEEASHKATKARLADKSKIESIEGAKSE
AMKDMEQKLQEERASKLRVENRMLELEKHSSMLDCDYKQSLQKLDELRRHKERLTEEVKN
LTLKIEQETQKRSLTQNDLKAQNQQLNALKTSEKQLKQEANHLLEIKRSLEKQNQELRKE
RQDSDGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKSKLYKDIQQSLQELQEERDSL
AAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELELKEMMARHKQELGEKDITIGSL
EEANRTLTSDVANLANEKEELNNKLRETLEELQTSKDDEQQMSQMKLMFEKHLQSERTLK
TQAVNKLAEIMNRKEVRAAGSRRGNDTDVRRKEKENRKLQLELRSEKEKLNSSIIKYQRE
INDMQAQIADESQVRIELQMALDSKDSDIEQLRNLLSSANVSSLESASINSGPDFDADDA
YTEMRLEGWLSLPVRNNTKKFGWERKYVVVSSKKILFYNSEQDKELSNPYMVLDIDKLFH
VRPVTQTDVYRADAKEIPRIFQILYANEGECKKEPEFPVELASGEKSSYICHKGHEFIPT
LYHFPTNCEACTKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVNYDVSMAKN
LLLLAVSQEEQQEWVGRLVKKITKKPPAPDHFARSSPRVSMKVQPSQSMRRPSRQLPPSK
NRLLDFGLQDWHWELDDIDDDAFDF
NT seq 4218 nt   +upstreamnt  +downstreamnt
atgtcgcttggtgcagagagaaggatggaaaaccggttgaaaaagctggaggccatgatc
aaagatccaagatctgcgataaacttagaaagtttactggattctatcaatgccttcgtt
ctagatctggactaccctgccctacggaaaaacaaaaacatagaaacctttttaaacaga
tatgagaaggtgatggggcacatacgggactttcagatgaggtctgaggactttgacagg
gtgaaagtgatcggcagaggggcgtttggtgaggttcagctggttcgacacaaagcctct
cagaaagtgtatgccatgaagttgctgagcaagtttgagatgatcaaacgatctgactct
gccttcttctgggaggagagggatattatggccttcgccaacagtccctgggttgtacaa
ttgtgctgtgccttccaagatgaccgttacctctacatggtgatggagtacatgcctgga
ggggacctggtgaacctcaccagtacctacgatgtacctgagaagtgggcccggttctat
acggccgaggtggtcatggcactggatgccatccactccctgggtttcatccaccgcgac
gtcaagcctgacaacatgctcctggaccgccacggacacctcaaactggccgacttcgga
acctgcatgaagatggactcgactgggatggtgcactgtgacacagcggttggcactcca
gactacatctctcctgaggttctgaagtcgcagggtggagatggttactatggacgggag
tgtgactggtggtctgtaggggtcttcatcttcgagatgctagtcggtgacacaccgttc
tatgccgactcccttgttggaacctacagtaagatcatggaccacaagaattccctcaac
tttccagatgacgtagagatctccaaagatgccaaaaacttaatctgtgccttcttgaca
gacagggaggtacgactgggccgcaacggggtggaggagatcaagcgacacccctttttc
aagaatgaccaatggaactttgacagcattagaaacacggccgctcctgtggttccagaa
ttgagcagtgacattgacaccagtaactttgatgagatagaagatgacaagggtgacgtg
gagaccttccctactcctaaggcctttgtggggaaccagcttcccttcgtcggcttcaca
tacttcaaggaggaccagttactaagcggtgtaaataactcaacagttgtgactgtgaac
tcaacagccttgaaaggagaggatattgtgatgtcagccaagctgcagaagaaactccac
cagctggaagagcagctcaataatgagatgcagaccaaagatgagctggagcacaagtgc
agaactgccaccagtcgtctagagaaaacctccaaagatcttgatgaagaagtgagtagc
aggaaggctctggagtcgagtctgaggcagctggagagagagaaggctctactgcagcac
aagactgtggagagccatcgcaaggcagagagtgaggcagacaggaaacgctgcctggag
aacgaggtcaacagcctacgagaccagctggacgaaatgaagaagagaaatcagaactca
cacatatccaacgagaaaaacattcacttacaaagacagctggatgaggccaatgctctg
ttgcgtgcggagcaggaggtggccacaaggctgaggaaggcccagacggaaacaggcaag
cagctgcaagctctggaggctgggggcagagagctgcaggacaagtgctgcctgctggag
cgctccaagctcacgctggagaaggagttcatcgggctgcaggcagcactggaggctgag
aggagagaacacagccagggctctgagaccatcacagacatgcaggggcgaatctcgggg
ctggagaatgaggtttggcaggtgagacaggccctttccaaggcagagactgagaagaga
caactacaggagaaactcactgctctggagaaggagaagaacaacaaggaaatagacatg
acgtacaagctgaaggtgttgcaacaggggctggagcaggaggaggcatcacacaaagcc
accaaggcacggctcgcggacaagagcaagattgagtcgatcgaaggcgccaaatctgag
gccatgaaggatatggagcagaagctgcaggaggagagggcgtcaaagctgcgtgtggag
aacaggatgttggagctggagaaacatagcagcatgctggactgtgactacaagcagtcc
ctgcagaaactagacgagcttcgcaggcacaaggagaggctcaccgaggaggtgaagaac
ctgaccctgaagattgagcaagagacccagaagcgcagtcttacccagaacgacctgaag
gcccagaaccagcagctaaatgccctgaagacctctgagaagcagctgaaacaggaggcc
aaccacctgctggaaatcaaacgcagcctggagaaacagaaccaggagctacgcaaagaa
aggcaggactcagatggccaaatgaaggaacttcaggaccagctagaggctgagcagtat
ttttctacgctgtataagacccaggtgcgggagttgaaggaggaatgtgaagagaagagc
aaactctacaaggacatacagcagtcacttcaggagttacaagaggagagggactccctg
gcggcgcagctggagatcactctgaccaaagcagactcggagcagctggctcgctccatc
gctgaggagcagtactcagacctggagaaggagaagatcatgaaggagctggagctcaag
gagatgatggcccgacacaagcaggagctgggcgagaaggacatcacaatcggctcgctg
gaggaggccaaccgaaccctcaccagcgacgtggctaacctggccaatgagaaggaggag
ctcaacaacaaactcagggagacgcttgaagagctgcagacgtccaaggatgacgaacag
cagatgagccagatgaagctcatgtttgagaagcacctccagtcagagagaacactgaag
acccaggctgtgaacaagctggcggagatcatgaacaggaaggaggtacgtgcggcaggc
agtcggcgcggcaacgacactgacgtacgcaggaaggagaaggagaataggaagctgcag
ctggagctgagatcggagaaggagaaactcaactcttccatcatcaagtaccagagagag
atcaacgacatgcaggcgcaaatagctgatgagagtcaggtacgcattgagctgcagatg
gccctggacagtaaggatagtgacatagagcagctacgtaacctcctcagctccgccaat
gtttcctccctggaatcagccagtatcaacagtggaccagactttgatgcggacgacgcc
tacacagaaatgagactagagggatggctctcactgccggtgaggaacaacacaaagaag
tttggatgggagagaaagtatgtggttgtgagcagcaagaagattctgttctataacagc
gaacaggacaaagagctatccaacccctacatggtgctggatatcgataaactcttccat
gtgcgacctgtcactcaaacagatgtttaccgtgctgacgccaaagagatccccaggata
ttccagattctgtatgccaacgagggagagtgtaagaaggagcctgagttcccagtggag
ctggcaagtggagagaagtccagctacatctgccacaagggccatgagttcatccctaca
ctctaccactttcctaccaactgtgaggcgtgcaccaagcccctgtggcacatgtttaag
cctcctcctgccctggagtgcaggcgctgccacatcaagtgtcacaaggaccacatggac
aagaaggaagagatcatcgcaccctgcaaagtgaactatgatgtgtccatggccaagaac
ttgctgctgctggctgtgtcgcaggaggagcagcaagagtgggtgggacgactggtcaag
aagatcacaaagaagccgccggcccctgaccactttgcccgctcctcgccccgtgtctcc
atgaaggtccagcccagccagtccatgaggcggcccagcagacagctgccccccagcaag
aacagattgctcgactttggcctacaggactggcattgggagttagatgatatcgatgat
gatgcttttgatttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246839
Entry
112246839         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 2-like isoform X1
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112246839
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246839
   04530 Tight junction
    112246839
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112246839
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112246839
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112246839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112246839
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112246839
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112246839
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112246839
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112246839
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil Pkinase_C
Other DBs
NCBI-GeneID: 112246839
NCBI-ProteinID: XP_024271170
LinkDB
Position
Unknown
AA seq 1405 aa
MSLGAERRMENRLKKLEAMIKDPRSAINLESLLDSINAFVLDLDYPALRKNKNIETFLNR
YEKVMGHIRDFQMRSEDFDRVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAFANSPWVVQLCCAFQDDRYLYMVMEYMPGGDLVNLTSTYDVPEKWARFY
TAEVVMALDAIHSLGFIHRDVKPDNMLLDRHGHLKLADFGTCMKMDSTGMVHCDTAVGTP
DYISPEVLKSQGGDGYYGRECDWWSVGVFIFEMLVGDTPFYADSLVGTYSKIMDHKNSLN
FPDDVEISKDAKNLICAFLTDREVRLGRNGVEEIKRHPFFKNDQWNFDSIRNTAAPVVPE
LSSDIDTSNFDEIEDDKGDVETFPTPKAFVGNQLPFVGFTYFKEDQLLSGVNNSTVVTVN
STALKGEDIVMSAKLQKKLHQLEEQLNNEMQTKDELEHKCRTATSRLEKTSKDLDEEVSS
RKALESSLRQLEREKALLQHKTVESHRKAESEADRKRCLENEVNSLRDQLDEMKKRNQNS
HISNEKNIHLQRQLDEANALLRAEQEVATRLRKAQTETGKQLQALEAGGRELQDKCCLLE
RSKLTLEKEFIGLQAALEAERREHSQGSETITDMQGRISGLENEVWQVRQALSKAETEKR
QLQEKLTALEKEKNNKEIDMTYKLKVLQQGLEQEEASHKATKARLADKSKIESIEGAKSE
AMKDMEQKLQEERASKLRVENRMLELEKHSSMLDCDYKQSLQKLDELRRHKERLTEEVKN
LTLKIEQETQKRSLTQNDLKAQNQQLNALKTSEKQLKQEANHLLEIKRSLEKQNQELRKE
RQDSDGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKSKLYKDIQQSLQELQEERDSL
AAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELELKEMMARHKQELGEKDITIGSL
EEANRTLTSDVANLANEKEELNNKLRETLEELQTSKDDEQQMSQMKLMFEKHLQSERTLK
TQAVNKLAEIMNRKEVRAAGSRRGNDTDVRRKEKENRKLQLELRSEKEKLNSSIIKYQRE
INDMQAQIADESQVRIELQMALDSKDSDIEQLRNLLSSANVSSLESASINSGPDFDADDA
YTEMRLEGWLSLPVRNNTKKFGWERKYVVVSSKKILFYNSEQDKELSNPYMVLDIDKLFH
VRPVTQTDVYRADAKEIPRIFQILYANEGECKKEPEFPVELASGEKSSYICHKGHEFIPT
LYHFPTNCEACTKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVNYDVSMAKN
LLLLAVSQEEQQEWVGRLVKKITKKPPAPDHFARSSPRVSMKVQPSQSMRRPSRQLPPSK
NRLLDFGLQDWHWELDDIDDDAFDF
NT seq 4218 nt   +upstreamnt  +downstreamnt
atgtcgcttggtgcagagagaaggatggaaaaccggttgaaaaagctggaggccatgatc
aaagatccaagatctgcgataaacttagaaagtttactggattctatcaatgccttcgtt
ctagatctggactaccctgccctacggaaaaacaaaaacatagaaacctttttaaacaga
tatgagaaggtgatggggcacatacgggactttcagatgaggtctgaggactttgacagg
gtgaaagtgatcggcagaggggcgtttggtgaggttcagctggttcgacacaaagcctct
cagaaagtgtatgccatgaagttgctgagcaagtttgagatgatcaaacgatctgactct
gccttcttctgggaggagagggatattatggccttcgccaacagtccctgggttgtacaa
ttgtgctgtgccttccaagatgaccgttacctctacatggtgatggagtacatgcctgga
ggggacctggtgaacctcaccagtacctacgatgtacctgagaagtgggcccggttctat
acggccgaggtggtcatggcactggatgccatccactccctgggtttcatccaccgcgac
gtcaagcctgacaacatgctcctggaccgccacggacacctcaaactggccgacttcgga
acctgcatgaagatggactcgactgggatggtgcactgtgacacagcggttggcactcca
gactacatctctcctgaggttctgaagtcgcagggtggagatggttactatggacgggag
tgtgactggtggtctgtaggggtcttcatcttcgagatgctagtcggtgacacaccgttc
tatgccgactcccttgttggaacctacagtaagatcatggaccacaagaattccctcaac
tttccagatgacgtagagatctccaaagatgccaaaaacttaatctgtgccttcttgaca
gacagggaggtacgactgggccgcaacggggtggaggagatcaagcgacacccctttttc
aagaatgaccaatggaactttgacagcattagaaacacggccgctcctgtggttccagaa
ttgagcagtgacattgacaccagtaactttgatgagatagaagatgacaagggtgacgtg
gagaccttccctactcctaaggcctttgtggggaaccagcttcccttcgtcggcttcaca
tacttcaaggaggaccagttactaagcggtgtaaataactcaacagttgtgactgtgaac
tcaacagccttgaaaggagaggatattgtgatgtcagccaagctgcagaagaaactccac
cagctggaagagcagctcaataatgagatgcagaccaaagatgagctggagcacaagtgc
agaactgccaccagtcgtctagagaaaacctccaaagatcttgatgaagaagtgagtagc
aggaaggctctggagtcgagtctgaggcagctggagagagagaaggctctactgcagcac
aagactgtggagagccatcgcaaggcagagagtgaggcagacaggaaacgctgcctggag
aacgaggtcaacagcctacgagaccagctggacgaaatgaagaagagaaatcagaactca
cacatatccaacgagaaaaacattcacttacaaagacagctggatgaggccaatgctctg
ttgcgtgcggagcaggaggtggccacaaggctgaggaaggcccagacggaaacaggcaag
cagctgcaagctctggaggctgggggcagagagctgcaggacaagtgctgcctgctggag
cgctccaagctcacgctggagaaggagttcatcgggctgcaggcagcactggaggctgag
aggagagaacacagccagggctctgagaccatcacagacatgcaggggcgaatctcgggg
ctggagaatgaggtttggcaggtgagacaggccctttccaaggcagagactgagaagaga
caactacaggagaaactcactgctctggagaaggagaagaacaacaaggaaatagacatg
acgtacaagctgaaggtgttgcaacaggggctggagcaggaggaggcatcacacaaagcc
accaaggcacggctcgcggacaagagcaagattgagtcgatcgaaggcgccaaatctgag
gccatgaaggatatggagcagaagctgcaggaggagagggcgtcaaagctgcgtgtggag
aacaggatgttggagctggagaaacatagcagcatgctggactgtgactacaagcagtcc
ctgcagaaactagacgagcttcgcaggcacaaggagaggctcaccgaggaggtgaagaac
ctgaccctgaagattgagcaagagacccagaagcgcagtcttacccagaacgacctgaag
gcccagaaccagcagctaaatgccctgaagacctctgagaagcagctgaaacaggaggcc
aaccacctgctggaaatcaaacgcagcctggagaaacagaaccaggagctacgcaaagaa
aggcaggactcagatggccaaatgaaggaacttcaggaccagctagaggctgagcagtat
ttttctacgctgtataagacccaggtgcgggagttgaaggaggaatgtgaagagaagagc
aaactctacaaggacatacagcagtcacttcaggagttacaagaggagagggactccctg
gcggcgcagctggagatcactctgaccaaagcagactcggagcagctggctcgctccatc
gctgaggagcagtactcagacctggagaaggagaagatcatgaaggagctggagctcaag
gagatgatggcccgacacaagcaggagctgggcgagaaggacatcacaatcggctcgctg
gaggaggccaaccgaaccctcaccagcgacgtggctaacctggccaatgagaaggaggag
ctcaacaacaaactcagggagacgcttgaagagctgcagacgtccaaggatgacgaacag
cagatgagccagatgaagctcatgtttgagaagcacctccagtcagagagaacactgaag
acccaggctgtgaacaagctggcggagatcatgaacaggaaggaggtacgtgcggcaggc
agtcggcgcggcaacgacactgacgtacgcaggaaggagaaggagaataggaagctgcag
ctggagctgagatcggagaaggagaaactcaactcttccatcatcaagtaccagagagag
atcaacgacatgcaggcgcaaatagctgatgagagtcaggtacgcattgagctgcagatg
gccctggacagtaaggatagtgacatagagcagctacgtaacctcctcagctccgccaat
gtttcctccctggaatcagccagtatcaacagtggaccagactttgatgcggacgacgcc
tacacagaaatgagactagagggatggctctcactgccggtgaggaacaacacaaagaag
tttggatgggagagaaagtatgtggttgtgagcagcaagaagattctgttctataacagc
gaacaggacaaagagctatccaacccctacatggtgctggatatcgataaactcttccat
gtgcgacctgtcactcaaacagatgtttaccgtgctgacgccaaagagatccccaggata
ttccagattctgtatgccaacgagggagagtgtaagaaggagcctgagttcccagtggag
ctggcaagtggagagaagtccagctacatctgccacaagggccatgagttcatccctaca
ctctaccactttcctaccaactgtgaggcgtgcaccaagcccctgtggcacatgtttaag
cctcctcctgccctggagtgcaggcgctgccacatcaagtgtcacaaggaccacatggac
aagaaggaagagatcatcgcaccctgcaaagtgaactatgatgtgtccatggccaagaac
ttgctgctgctggctgtgtcgcaggaggagcagcaagagtgggtgggacgactggtcaag
aagatcacaaagaagccgccggcccctgaccactttgcccgctcctcgccccgtgtctcc
atgaaggtccagcccagccagtccatgaggcggcccagcagacagctgccccccagcaag
aacagattgctcgactttggcctacaggactggcattgggagttagatgatatcgatgat
gatgcttttgatttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260654
Entry
112260654         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 1-like isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112260654
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260654
   04530 Tight junction
    112260654
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260654
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112260654
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260654
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112260654
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112260654
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112260654
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112260654
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH HR1 Cortex-I_coil C1_1 Filament Pkinase_C APH
Other DBs
NCBI-GeneID: 112260654
NCBI-ProteinID: XP_024291697
LinkDB
Position
10
AA seq 1385 aa
MSAGESLEARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATMKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSALVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHAMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
EDSDISKDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRETAAPVVPELS
SDIDTSNFDEIEEDRGDEETFPIPKAFVGNQLPFVGFTYYSSHQFSRSTSTKSVDKRSSS
TKEDKSHLENLQKRIYQLEEQLHSEMQLKDEMEQKCRTTNTKLDKIMKELDEEANVRKGV
EASMSLLEKDKMMIQHRATEYQRKVDQEAEKRRNMENEVSTLKEQLEVMRKISQNSQASN
DKILQLQKQLEEANDLLRVESDTAARLRKSHTEMAKSMSQLEGLTSELQEKSRSADGGKA
QLEKELLQLQSTLDSERRSYSQGSEEIHELQARMTGLQQDNKNLKLSLSKVETERKQAQE
RSNNLEKDKNNLEIDLNYKLKTLQQRLDQEHTEHRVTRAQLTDKYESIEEAKSAAMHAVQ
HKVSEESGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVQALRIHLE
QESSKRLLAQNELKSRSQEADRLKGSEKQLKQEINTALENKRSLEFQLAQLTKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEEIEERNRQLQDVHKKVHELHSERDSLSAQLDL
TVTKAESEQLARALQEEQYFELSQENKKAMARHKQEGSERDSTIARLEESNKTLTKDVEN
LSKEKAELDHKLRTQKEEYDSQKEEITNTIKANYEKVLSTERTLKTQAVNKLAEIMNRKD
MKLDTKKKGSTTDLRKKEKENRKLQVDLNQEKEKFNHMAIKYQKELSEMQAQLSEECTYR
NELQMQLDSKESDIEQLREKLNDLQLRMDNSSVISLQTDETDSNIAESRLEGWLSIPNKP
NIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEE
IPRIFQILYANEGECRKEADMETVSQGDKTNCLPHKGHEFIPTLYHFPSNCEACSKPLWN
VFKPPHALECRRCHVKCHRDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWIGH
LGKKIPKTPPSSFLRASPRTLSTRSGTNQSFRKNPKSITGKPRSQSHSATTASSLQATDT
TSSTC
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgtctgctggagaaagtttggaggctcgttttgagaaaatcgatgccatgttgaaggac
ccgaagtcggaaataaacacggattgccttttggatggcttggacgcgttggtgtacgac
ctggactttccagccctgagaaaaaacaaaagcatcgacaacttcttgaatagatataag
gacaccatcagtaagatccgggacctgcggatgaaagcagaggactatgaggtggtcaag
gttatcgggaggggggcgtttggagaagtgcagttggtaagacacaaagccactatgaag
gtgtatgccatgaagctgcttagcaagtttgagatgataaagaggtcggactctgctttc
ttctgggaggagagggacatcatggcctttgccaacagcgccctggtggtacagctgttt
tatgcgttccaggacgatcgttacctctacatggtgatggagtacatgcccggcggagac
ctggtcaacttgatgagcaactatgacgtccccgagaagtgggcccgcttttacaccgcc
gaggtggtgctggctctggacgggatccacgccatgggattcatacacagggacgtgaag
cctgataacatgttgctagacaaagcaggccacttgaagttggcagactttgggacctgt
atgaaaatgaacaaggacggtatggtccgatgcgacacagcagtgggaacgccagactac
atttcgccagaggtactaaaatcccagggaggagatggatattatggccgggagtgtgac
tggtggtccgtgggagtattcctatatgagatgcttgtcggtgacacaccgttctacgct
gactcgttggtggggacgtacagtaagatcatgaaccacaagaacgcactgaccttccct
gaagacagcgacatctccaaggatgccaagaacctcatttgtgccttcctgactgacagg
gaggtgcgactgggccgtaacggggtggatgagatcaagaggcatcctttcttcaagaac
gaccagtggacatgggagaacatccgagagacggcggccccggtagtgcctgagctgagc
agtgacatcgacaccagtaactttgacgaaattgaggaggaccggggagacgaggagacc
ttccccataccgaaggccttcgtgggcaaccagctgccctttgtggggttcacctactat
agcagtcaccagttctcccggagcaccagcaccaagagtgttgacaaacgcagcagctcc
accaaggaggacaagagccacctggagaacctgcagaagaggatctaccagctggaggag
cagctacatagtgagatgcagctaaaggatgagatggagcaaaagtgcaggacgacaaat
acaaaactcgacaagatcatgaaagagctggacgaggaggccaacgtgaggaagggtgtg
gaggccagtatgtccctcctggagaaagacaagatgatgatccagcaccgagccacagag
taccaaagaaaggtcgaccaggaggccgaaaagagacgcaacatggagaatgaggtgtcc
actctcaaagagcagcttgaggtcatgaggaaaatcagccaaaactctcaggcctcaaat
gacaagatcctacaactgcagaagcagctggaggaggccaatgacctgctgagggtggag
tcggacacggcggctcggctgagaaagagccacacggagatggccaagtccatgagccag
ctggaggggctgaccagcgagctgcaggagaagagccgctcggccgacggggggaaggcc
cagctggagaaagagctgctgcagctgcagagcaccctggactctgagaggaggagctac
agtcagggatcagaggagatccatgagctacaagcgcgaatgacgggtcttcaacaggac
aataagaacttgaagctcagcctgtccaaagtggagacggaacgcaagcaggcccaggag
aggagcaacaacctggagaaggataagaacaacctggagatcgacctgaactacaagcta
aagacactgcagcagcgtctggaccaggagcacacagaacacagggtgacgcgggcccag
ctcactgacaaatacgagtccattgaggaggccaagtcggctgccatgcatgcggtgcag
cataaagtgtctgaggagagcggggcgcggatgcgagcggagagcagggtggtggaggta
gagaagcagtgctccatgctggagtttgacctcaagcagtcggtgcagaagatggagcag
ctgatgaagcagaaggagaggcttgaggacgaggtgcaggctttgcggatccatctggag
caggagtccagtaagaggctgctggcccagaacgagctcaagagccgctcccaggaggcg
gaccggctgaagggctcggagaagcagctgaagcaagagatcaacacggcactagagaac
aagcgctctctcgagttccagctagcacagctcaccaagcaatacaggggcaacgaggga
cagatgagggaacttcaggaccagcttgaggccgaacagtatttctcaacgctttataaa
actcaggtgaaggaactgaaggaagagatcgaggagaggaaccggcagctccaggatgtt
cacaagaaggtgcatgagctgcacagcgaaagggactccctgtcagcccagctggatctg
acagtgaccaaggcggagtctgagcagctggccagggcgctccaggaggagcagtacttt
gagctgagccaggagaacaaaaaggccatggccagacacaagcaggagggttccgagagg
gattcaaccatcgcacggcttgaggaatccaacaaaaccctgaccaaagacgtggagaac
ctcagtaaggagaaggccgagctggaccacaagcttcgcactcagaaggaagagtatgac
tcccagaaagaggagattacaaacacaatcaaggccaactatgagaaggttctcagcaca
gagcgcacgctcaagactcaggcggtgaacaaactggcagagatcatgaacaggaaggac
atgaagcttgacaccaagaagaaggggagcacgaccgacctgaggaagaaggagaaggag
aaccgcaagctgcaggtggatctcaaccaggagaaggaaaagttcaaccacatggccatc
aagtaccagaaggagctcagcgagatgcaggcgcaactgtcggaggagtgcacgtaccgc
aatgagctgcagatgcagctggacagcaaggagagtgacattgagcagctcagggagaag
ctcaacgacctgcagctgcgcatggacaactccagtgtcatcagcctgcagacggatgag
acggacagcaacattgctgaatccagattggaaggttggctgtccattcctaataaacct
aatatcaaacgatatggctggaagaagcagtatgtggtggtgagcagcaagaagattctg
ttctacaacgatgaacaggacaaagaacagtccaacccctccatggtactagatatcgac
aaactgttccacgtgcgtccagttacccagggtgatgtgtaccgagcagagacggaggag
atcccaaggatattccagatcctgtatgccaacgagggggagtgcaggaaggaggcggac
atggagactgtctcgcaaggggacaagaccaactgtctgccccacaaaggtcacgagttc
atccccacgctctaccacttcccttccaactgtgaagcctgctccaagcccctgtggaat
gtcttcaagcctccacacgccttggagtgccgccgctgccacgtcaagtgccacagggac
cacctcgacaagaaggaggacgtcatcgccccctgcaaagtgaactacgatgtgacctct
gcccgggacatgctcctgctggccttgacacaagacgagcagaagaaatggatcggccac
ctgggcaagaagatccccaaaacaccgccctcctccttcctgagggcgtcgccccgcacc
ctgtccacccgctccggaaccaaccagtcctttcgcaagaatcccaaaagcataacgggc
aagccaaggtcgcagtctcattctgctaccacagcctccagcctccaagcaacagacaca
acatccagcacttgttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261645
Entry
112261645         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 2-like isoform X1
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112261645
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112261645
   04530 Tight junction
    112261645
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112261645
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112261645
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112261645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112261645
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112261645
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112261645
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112261645
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112261645
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Myosin_tail_1 Cortex-I_coil Pkinase_C Seadorna_VP7
Other DBs
NCBI-GeneID: 112261645
NCBI-ProteinID: XP_024292898
LinkDB
Position
11
AA seq 1408 aa
MSLGAERRMENRLKKLEAMIKDPRSAINLESLLDSINAFVLDLDYPALRKNKNVETFLNR
YEKVMGHLRDFQMKSEDFDRVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAFANSPWVVQLCCAFQDDRYLYMVMEYMPGGDLVNLTSTYDVPEKWARFY
TAEVVMALDAIHSLGFIHRDVKPDNMLLDRHGHLKLADFGTCMKMDSTGMVHCDTAVGTP
DYISPEVLKSQGGDGYYGRECDWWSVGVFIFEMLVGDTPFYADSLVGTYSKIMDHKNSLN
FPDDVEISKDAKNLICAFLTDREVRLGRNGVEEIKRHPFFKNDQWNFDSIRNTAAPVVPE
LSSDIDTSNFDEIEDDKGDVETFPTPKAFVGNQLPFVGFTYFKEDQLLSGVNNSTVVTVN
STALKGESAKLQKKLHQLEEQLNNEMQTKDELEHKCRTSTSRLEKISKELDEETSSRKAL
ESSLRQLEREKALLQHKTVESHRKAESEADRKRCLENEVNSLRDQLDDMKKRNQNSHISN
EKNIHLQRQLDEANALLRAEQEAATRLRKAQTEAGKQLQALEAGGRELQDKCCLLERSKL
TLEKECIGLQAALEAERREHSQGSETIADMQGRISGLEDEVRQVRQALSKAETEKRLLQE
KLTDLEKEKSSKEIDMTYKLKVLQQGLEQEEASHKATKARLADKSKIESIEGAKSEAMKG
KALPELSDMEQKLQEERASKLRVENRMLELEKHSSMLDCDYKQSLQKLDELRRHKERLTE
EVKNLTLKIEQETQKRSLTQNDLKAQNQQLNTLRTSEKQLKQEANHLLEIKRSLEKQNQE
LRKERQDSDGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKSKLYKDMQQSLQELQEE
RDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELELKEMMARHKQELVEKDIT
IGSLEEANRTLTSDVANLANEKEELNNKLKETLEELQTSKDDEQQMSQMKLTFEKQLQSE
RTLKTQAVNKLAEIMNRKEVRAAGSRRGNDTDVRRKEKENRKLQLELRSEKEKLNSTIIK
YQREINDMQAQIADESQVRIELQMALDSKDSDIEQLHNLLSSANVSSLESASLSSGPDFD
ADDAYTEMRLAGWLSLPVRNNTKKFGWERKYVVVSSKKILFYNSEQDKELSNPYMVLDID
KLFHVRPVTQTDVYRADAKEIPRIFQILYANEGECKKEPEFPVELASGEKSSYICHKGHE
FIPTLYHFPTNCEACTKPLWNMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCRVNYDVS
TAKNLLLLAVSQEEQQKWVGRLVKKIPKKPPAPEHFSRSSPRSSMKVQPSQSMRRPSRQL
PPSKSSPPRSHAPRMRREDSKSGHRHKS
NT seq 4227 nt   +upstreamnt  +downstreamnt
atgtcacttggtgcagagagaaggatggaaaaccggttgaaaaagctggaggccatgatc
aaagatccaagatctgcgataaacttggaaagtttactcgattctatcaatgccttcgtt
ctagatctagactaccctgccctacggaaaaacaaaaatgtagaaacctttttaaacaga
tatgagaaggtgatggggcacctacgggactttcagatgaagtctgaggactttgacagg
gtgaaggtgatcggcagaggggcgtttggggaggttcagctggttcgacacaaagcctct
cagaaagtgtacgccatgaagctgctgagcaagtttgagatgataaaacgctcagactca
gcctttttctgggaggagagggatattatggccttcgccaacagtccctgggtcgtacaa
ttgtgctgtgccttccaagacgaccgttacctttacatggtgatggagtacatgcctgga
ggggacctggtgaacctcaccagtacctacgatgtgcctgagaagtgggcccggttctac
acggccgaggtggtcatggcactggatgccatccactccctgggtttcatccaccgcgac
gtcaagcctgacaacatgctcctggaccgccacggacacctcaaactggccgacttcgga
acctgcatgaagatggactctactgggatggtgcactgtgacacagcggttggcactcca
gactacatctctccagaggttctaaagtcgcagggtggagatggttactacggacgggag
tgtgactggtggtctgtaggggtcttcatcttcgagatgctagtcggtgacacaccattc
tatgccgactcccttgttggaacatacagcaagatcatggatcacaagaattccctcaac
tttccagatgacgtagagatctccaaagacgccaaaaacctcatctgtgccttcctgaca
gacagggaggtgcgactgggccgcaacggggtggaggagatcaaacgacacccctttttc
aagaatgaccaatggaactttgacagcatcagaaatacggcggctcctgtggttccagag
ttgagcagtgacattgacactagcaactttgatgagatagaagatgacaagggtgacgtg
gagacctttcctactcctaaggcttttgtgggaaaccagcttcctttcgtcggcttcaca
tacttcaaggaagaccagttactaagtggtgtgaataactctacagttgtgaccgtgaac
tcaacagccttgaaaggagagtcggccaagctacagaagaaactccaccagctggaagag
cagctcaataatgagatgcagaccaaagatgagctggaacacaagtgcagaacttccacc
agtcgtctagagaaaatctccaaagaacttgatgaagagacgagtagcagaaaggctctg
gagtcgagtctgaggcagctggagagagagaaggctctactgcagcacaagactgtggag
agccaccgcaaggccgaaagcgaggccgaccggaaacgctgcctggagaacgaggtcaac
agcctccgagaccagctggatgatatgaagaaaagaaatcagaactcgcacatatccaac
gagaagaacattcacttacaaagacagctggacgaggccaatgctctattgcgtgcggag
caggaggcggctacgcggctgaggaaggcccagacggaggcaggcaagcagctacaggct
ctggaggccgggggcagagagctgcaggacaagtgctgcctgctggagcgctccaagctc
actctggagaaggagtgtatcgggctgcaggcagcactggaggctgagaggagagagcac
agccagggctcagagaccatcgcagacatgcaggggcgaatctcagggctggaggatgag
gttcggcaggtgagacaagccctatccaaagcagagacagagaagagactactacaggag
aaactcaccgacctggagaaggagaagagcagcaaggagatagacatgacgtacaagctg
aaggtgttgcagcaggggctggagcaggaggaggcgtcgcacaaagccaccaaggcacgg
ctcgcagacaagagcaagattgagtcgatcgagggcgccaagtctgaggccatgaagggt
aaggcccttcctgagttatcagacatggagcagaagctgcaggaggagagggcgtccaag
ctgcgtgtggagaacaggatgttggagctggagaaacacagcagcatgctggattgtgac
tacaagcagtccctacagaaactggatgagctccgcaggcacaaggagaggctcaccgag
gaggtgaagaacctaactttgaagatcgagcaggagacccagaagcgcagtctgacccag
aatgacctgaaggcccagaaccagcagctcaacaccctgaggacctctgagaagcagctg
aaacaggaggctaaccacctgctggaaatcaaacgcagcctggagaaacaaaaccaggag
ctacgcaaagaaaggcaggactcggacggccaaatgaaggaacttcaggaccagctagag
gctgagcagtatttttcgacgctgtataagacccaggtgcgggagttgaaggaggaatgt
gaagagaagagcaagctctacaaggacatgcagcaatcccttcaggagttacaagaggag
agggactccctggcggcgcagctggagatcacgctgaccaaggcggactcggagcagctg
gctcgctccatcgctgaggagcagtactccgacctggagaaggagaaaatcatgaaggag
ctggagctcaaagagatgatggctcggcacaagcaggagctggtcgagaaggacattacc
attggctcgctggaggaggccaaccgaaccctcactagcgatgtggccaacttagccaat
gagaaagaggagctcaacaacaaactcaaggagacacttgaagagctgcagacgtccaag
gatgatgagcagcagatgagccagatgaagctcacatttgagaagcagctccagtcagag
agaacactaaagacccaggctgtgaacaagctggcggagatcatgaacaggaaggaggta
cgtgcagcaggcagtcggcgcggcaatgacactgatgtgcgcaggaaggagaaggagaac
aggaagttgcagctggagctgaggtcagagaaggagaaactcaactccaccatcatcaag
taccaaagagagatcaacgacatgcaggcgcaaatagcagatgagagtcaggtacgcatc
gagctgcagatggccctggacagtaaggacagtgacattgagcagctacataacctcctc
agctccgccaacgtctcctccctagaatcagccagcctcagcagtggaccagactttgac
gcggatgacgcctacacagaaatgagactagcggggtggctctcgctgcctgtgaggaac
aacaccaagaagtttggatgggagagaaagtatgtggttgtgagcagcaagaagattctg
ttctataacagcgaacaggacaaagagctgtccaacccctacatggtgctggatattgat
aaactcttccatgtgcggcctgtcactcaaacagacgtttaccgtgctgatgccaaagag
atccccaggatattccagattctgtatgccaatgagggagagtgtaagaaggagcctgag
ttcccagtggagctggccagtggagagaagtccagctacatctgccacaagggccacgag
ttcatccctacgctctaccacttccccaccaactgtgaggcgtgcaccaaacccctgtgg
aacatgtttaagcctccgcccgcgctggagtgcaggcgctgccacatcaagtgccacaag
gaccacatggacaagaaggaggagatcatcgcgccctgcagagtgaactatgacgtgtcc
acggccaagaacctgctgctgctggccgtgtctcaggaggaacaacagaagtgggtggga
cgtctggtcaagaagatccccaagaagcccccggcccccgagcacttttcccgctcctcg
ccccgttcctccatgaaggtccagcccagccagtccatgaggcggcccagcagacagctg
ccccccagcaagagcagtcctcctagatcacacgcccccaggatgcgacgagaagactcc
aaaagtggccatcgacacaaatcatga

DBGET integrated database retrieval system