KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217412
Entry
112217412         CDS       T05605                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta-like isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217412
   04310 Wnt signaling pathway
    112217412
   04340 Hedgehog signaling pathway
    112217412
   04371 Apelin signaling pathway
    112217412
   04020 Calcium signaling pathway
    112217412
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112217412
  09143 Cell growth and death
   04114 Oocyte meiosis
    112217412
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112217412
   04540 Gap junction
    112217412
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112217412
   04912 GnRH signaling pathway
    112217412
   04914 Progesterone-mediated oocyte maturation
    112217412
   04916 Melanogenesis
    112217412
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112217412
   04270 Vascular smooth muscle contraction
    112217412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112217412
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112217412
   03036 Chromosome and associated proteins [BR:otw03036]
    112217412
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112217412
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKA family
   112217412
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112217412
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112217412
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 112217412
NCBI-ProteinID: XP_024233443
LinkDB
Position
18
AA seq 386 aa
MAQGKDHSFLKLDDLASRFFNRYRKGNQEQKAQESEGPHVSEFTIIWDKLMKEFLAKAKE
DFLRKWECPPQSTTGLDDFDRLKTLGTGSFGRVMLVKHKGTEQFYAMKILDKQKVVKLKQ
IEHTLNEKRILQAVSFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHAR
FYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEY
LAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSD
LKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWITIYERKVEAPFIPKCRGPGDT
SNFDDYEEEDVRVSDTEKCAKEFSEF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcccagggaaaggatcattccttcctaaagctggacgaccttgccagccgattcttc
aacaggtatcgcaaaggcaaccaagagcaaaaagcccaggagagtgaggggcctcatgtc
tcagagttcaccatcatttgggataagttgatgaaagagttcttagccaaagcgaaagaa
gattttttacgaaaatgggagtgcccaccacagagcacaactggactggatgactttgac
aggctgaagactctgggcacaggctcgttcggtagagtgatgttggtgaaacataaagga
acagaacagttctacgccatgaagatcctggacaaacagaaagtggtgaagctgaagcag
atagaacacacgctaaacgaaaagagaatactgcaggcggtgtccttcccctttctcgtg
agactagagtattccttcaaggataactccaacctctacatggtgatggagtacgttcca
ggaggagaaatgttctcgcatctgagacgcatcgggaggttcagtgaacatcacgcacga
ttttatgcagctcagatagtactcacttttgagtacctccactcgctagaccttatctac
agagacctgaagcctgaaaaccttctcattgatcaccaagggtacatccaggtcacagac
tttggctttgccaaaagagtaaaaggcaggacctggacattgtgtggaactcctgagtac
ctggctccagagatcatcctcagcaagggctacaacaaagctgtggactggtgggcactg
ggagtcctgatctacgagatggctgccgggtaccctccgttcttcgctgatcagccaatc
cagatctacgagaagattgtgtctggcaaggtacgattcccctcccattttagctccgac
ttgaaagacctgctgaggaacctgctccaggtggacctgacgaagcgctacggcaacctg
aagaatggggtgaatgacatcaagaaccacaagtggtttgccacaacggactggatcaca
atctacgagaggaaggtggaagctcccttcataccaaagtgcagaggaccaggagacaca
agcaactttgacgactacgaagaggaggatgtccgtgtgtccgacacagaaaagtgtgcg
aaggagttttccgaattctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226218
Entry
112226218         CDS       T05605                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226218
   04310 Wnt signaling pathway
    112226218
   04340 Hedgehog signaling pathway
    112226218
   04371 Apelin signaling pathway
    112226218
   04020 Calcium signaling pathway
    112226218
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112226218
  09143 Cell growth and death
   04114 Oocyte meiosis
    112226218
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112226218
   04540 Gap junction
    112226218
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112226218
   04912 GnRH signaling pathway
    112226218
   04914 Progesterone-mediated oocyte maturation
    112226218
   04916 Melanogenesis
    112226218
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112226218
   04270 Vascular smooth muscle contraction
    112226218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226218
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112226218
   03036 Chromosome and associated proteins [BR:otw03036]
    112226218
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112226218
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKA family
   112226218
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112226218
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112226218
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 112226218
NCBI-ProteinID: XP_024246350
LinkDB
Position
27
AA seq 393 aa
MLWARTVGKTFSEVQRQRHNVFVIYGQTVSAGKHADPFSLHRLFTKHVTASNVITLKLKE
FLAKAKEDFLKKWENPAQNTAALDGFDRLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQ
KVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGR
FSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDNQGYIQVTDFGFAKRVKGRTWT
LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF
PSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPK
CKGPGDTSNFDDYEEEEIRVSFTEKCGKEFAEF
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgttgtgggcccgaacagtcgggaaaaccttctccgaagtccaaagacaacgtcacaat
gtcttcgtcatatatggacaaactgtttcggctgggaagcatgcagacccctttagtcta
caccgtttgtttacgaagcatgtgacagcatcaaatgttataacgctcaaattgaaggag
tttcttgccaaagccaaagaggatttcctcaagaaatgggagaatccagcacagaacacc
gcagccttggatggctttgaccgtctgaagaccctgggcacgggctcgtttggtcgagtc
atgctggtcaagcacaaagagtcgggccagcattttgccatgaagatacttgacaaacag
aaggtggtgaagctgaagcagatagaacacacgctgaatgagaaacgcatcctgcaggcc
gtcagcttccccttcctggtgcggttggagcactctttcaaggacaacactaacctgtat
atggtgatggagtacgtccctggcggtgagatgttctcacatctaaggagaattggcagg
ttcagtgagccccacgcccgcttctacgccgcccaaattgttctgacctttgaatacctt
cactcactggacctcatctaccgagatctgaaaccagagaacctgctcattgacaaccag
ggatacatacaggtaacagattttggttttgcaaagcgcgtgaagggccggacctggacg
ctgtgtggcactccggagtacctggcccctgaaatcatccttagcaaaggttataataag
gcggtggactggtgggctctgggcgtgctgatttatgagatggctgctggctatcctccc
ttctttgctgaccagcccattcaaatctatgagaagattgtatcagggaaggtgcgcttt
ccctcccacttcagctcagacctgaaggacctgctgaggaacctgctccaggtggacctg
accaagcgcttcggcaacctgcgcaacggagtcaacgacatcaagggacacaagtggttc
gccaccactgactggattgccatttaccagaggaaggtggaggcaccgtttattcccaag
tgcaaaggccccggtgacaccagcaactttgacgactaygaggaagaggaaatccgagtc
tccttcacagagaaatgtggcaaggagtttgccgagttctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233434
Entry
112233434         CDS       T05605                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta-like isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233434
   04310 Wnt signaling pathway
    112233434
   04340 Hedgehog signaling pathway
    112233434
   04371 Apelin signaling pathway
    112233434
   04020 Calcium signaling pathway
    112233434
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112233434
  09143 Cell growth and death
   04114 Oocyte meiosis
    112233434
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112233434
   04540 Gap junction
    112233434
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112233434
   04912 GnRH signaling pathway
    112233434
   04914 Progesterone-mediated oocyte maturation
    112233434
   04916 Melanogenesis
    112233434
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112233434
   04270 Vascular smooth muscle contraction
    112233434
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233434
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112233434
   03036 Chromosome and associated proteins [BR:otw03036]
    112233434
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112233434
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKA family
   112233434
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112233434
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112233434
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 112233434
NCBI-ProteinID: XP_024256834
LinkDB
Position
Unknown
AA seq 386 aa
MAQGKDHSFLKLDDLASRFFNRYRKGNQEQKAQESEGPHVSEFTIIWDKLMKEFLAKAKE
DFLRKWECPPQSTTGLDDFDRLKTLGTGSFGRVMLVKHKGTEQFYAMKILDKQKVVKLKQ
IEHTLNEKRILQAVSFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHAR
FYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEY
LAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSD
LKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWITIYERKVEAPFIPKCRGPGDT
SNFDDYEEEDVRVSDTEKCAKEFSEF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcccagggaaaggatcattccttcctaaagctggacgaccttgccagccgattcttc
aacaggtatcgcaaaggcaaccaagagcaaaaagcccaggagagtgaggggcctcatgtc
tcagagttcaccatcatttgggataagttgatgaaagagttcttagccaaagcgaaagaa
gattttttacgaaaatgggagtgcccaccacagagcacaactggactggatgactttgac
aggctgaagactctgggcacaggctcgttcggtagagtgatgttggtgaaacataaagga
acagaacagttctacgccatgaagatcctggacaaacagaaagtggtgaagctgaagcag
atagaacacacgctaaacgaaaagagaatactgcaggcggtgtccttcccctttctcgtg
agactagagtattccttcaaggataactccaacctctacatggtgatggagtacgttcca
ggaggagaaatgttctcgcatctgagacgcatcgggaggttcagtgaacatcacgcacga
ttttatgcagctcagatagtactcacttttgagtacctccactcgctagaccttatctac
agagacctgaagcctgaaaaccttctcattgatcaccaagggtacatccaggtcacagac
tttggctttgccaaaagagtaaaaggcaggacctggacattgtgtggaactcctgagtac
ctggctccagagatcatcctcagcaagggctacaacaaagctgtggactggtgggcactg
ggagtcctgatctacgagatggctgccgggtaccctccgttcttcgctgatcagccaatc
cagatctacgagaagattgtgtctggcaaggtacgattcccctcccattttagctccgac
ttgaaagacctgctgaggaacctgctccaggtggacctgacgaagcgctacggcaacctg
aagaatggggtgaatgacatcaagaaccacaagtggtttgccacaacggactggatcaca
atctacgagaggaaggtggaagctcccttcataccaaagtgcagaggaccaggagacaca
agcaactttgacgactacgaagaggaggatgtccgtgtgtccgacacagaaaagtgtgcg
aaggagttttccgaattctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247487
Entry
112247487         CDS       T05605                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112247487
   04310 Wnt signaling pathway
    112247487
   04340 Hedgehog signaling pathway
    112247487
   04371 Apelin signaling pathway
    112247487
   04020 Calcium signaling pathway
    112247487
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112247487
  09143 Cell growth and death
   04114 Oocyte meiosis
    112247487
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112247487
   04540 Gap junction
    112247487
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112247487
   04912 GnRH signaling pathway
    112247487
   04914 Progesterone-mediated oocyte maturation
    112247487
   04916 Melanogenesis
    112247487
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112247487
   04270 Vascular smooth muscle contraction
    112247487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112247487
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112247487
   03036 Chromosome and associated proteins [BR:otw03036]
    112247487
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112247487
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKA family
   112247487
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112247487
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112247487
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 112247487
NCBI-ProteinID: XP_024272025
LinkDB
Position
Unknown
AA seq 354 aa
MGNTATAKKGNELESETFVKEFLAKAKEDFLRKWECPPQSTTGLDDFDRLKTLGTGSFGR
VMLVKHKGTEQFFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLDYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDH
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKW
FATTDWIAIYERKVEAPFIPKCRGAGDTSNFDDYEEEEIRVSVTEKCAKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacactgctaccgccaagaaaggcaacgagcttgagagcgagacttttgtgaaa
gagtttctagccaaagccaaagaagacttcttacggaaatgggaatgtccaccacagagc
acgacgggcctagatgactttgacaggctaaagaccctgggtacaggctcgttcgggaga
gtcatgctggttaaacataaaggaacagagcagttcttcgccatgaaaatactggacaag
caaaaggtggtgaaactcaagcaaatagaacacacgctaaacgagaagagaatattgcag
gctgtgtcttttcccttcctcgtcagacttgactatgccttcaaggacaactccaatttg
tacatggtgatggagtacgttccaggaggagagatgttctcacatctaagacgaatcgga
aggttcagtgaaccgcacgcacggttttacgcagcccagatagtactgacgtttgagtac
cttcattcacttgaccttatctacagagatctgaagcctgagaaccttctaatcgatcac
cacggctacatccaggtgaccgactttggattcgccaagagggtaaaaggcagaacctgg
acgttgtgtggaactccagagtacctggcgcccgagatcatcctcagcaagggctacaac
aaagcagtggattggtgggccctgggggtccttatatatgagatggctgctggataccct
cccttcttcgctgaccagcccattcagatctatgagaagattgtgtctggaaaagtccgc
ttcccatcccacttcagctctgacctgaaggacctgctgaggaacctgctgcaggtggac
ctgaccaaacgctacggcaacctgaagaacggtgtaaacgacatcaagggacacaagtgg
ttcgccacaacggactggattgccatctacgagaggaaggtggaagccccgttcatacca
aagtgtcgaggcgctggagacacaagcaacttcgacgactatgaggaggaggagatccgc
gtctccgtaacggaaaaatgcgcaaaggagttttccgagttttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260598
Entry
112260598         CDS       T05605                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04540  Gap junction
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260598
   04310 Wnt signaling pathway
    112260598
   04340 Hedgehog signaling pathway
    112260598
   04371 Apelin signaling pathway
    112260598
   04020 Calcium signaling pathway
    112260598
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260598
  09143 Cell growth and death
   04114 Oocyte meiosis
    112260598
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112260598
   04540 Gap junction
    112260598
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260598
   04912 GnRH signaling pathway
    112260598
   04914 Progesterone-mediated oocyte maturation
    112260598
   04916 Melanogenesis
    112260598
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112260598
   04270 Vascular smooth muscle contraction
    112260598
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260598
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112260598
   03036 Chromosome and associated proteins [BR:otw03036]
    112260598
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112260598
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKA family
   112260598
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112260598
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112260598
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 112260598
NCBI-ProteinID: XP_024291608
LinkDB
Position
10
AA seq 354 aa
MGNTATAKKGNELESETFVKEFLAKAKEDFLRKWECPPQSTTGLDDFDRLKTLGTGSFGR
VMLVKHKGTEQFFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLDYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDH
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKW
FATTDWIAIYERKVEAPFIPKCRGAGDTSNFDDYEEEEIRVSVTEKCAKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacactgctaccgccaagaaaggcaacgagcttgagagcgagacttttgtgaaa
gagtttctagccaaagccaaagaagacttcttacggaaatgggaatgtccaccacagagc
acgacgggcctagatgactttgacaggctaaagaccctgggtacaggctcgttcgggaga
gtcatgctggttaaacataaaggaacagagcagttcttcgccatgaaaatactggacaag
caaaaggtggtgaaactcaagcaaatagaacacacgctaaacgagaagagaatattgcag
gctgtgtcttttcccttcctcgtcagacttgactatgccttcaaggacaactccaatttg
tacatggtgatggagtacgttccaggaggagagatgttctcacatctaagacgaatcgga
aggttcagtgaaccgcacgcacggttttacgcagcccagatagtactgacgtttgagtac
cttcattcacttgaccttatctacagagatctgaagcctgagaaccttctaatcgatcac
cacggctacatccaggtgaccgactttggattcgccaagagggtaaaaggcagaacctgg
acgttgtgtggaactccagagtacctggcgcccgagatcatcctcagcaagggctacaac
aaagcagtggattggtgggccctgggggtccttatatatgagatggctgctggataccct
cccttcttcgctgaccagcccattcagatctatgagaagattgtgtctggaaaagtccgc
ttcccatcccacttcagctctgacctgaaggacctgctgaggaacctgctgcaggtggac
ctgaccaaacgctacggcaacctgaagaacggtgtaaacgacatcaagggacacaagtgg
ttcgccacaacggactggattgccatctacgagaggaaggtggaagccccgttcatacca
aagtgtcgaggcgctggagacacaagcaacttcgacgactatgaggaggaggagatccgc
gtctccgtaacggaaaaatgcgcaaaggagttttccgagttttag

DBGET integrated database retrieval system