KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217528
Entry
112217528         CDS       T05605                                 

Definition
(RefSeq) tyrosine-protein kinase Fyn-like
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217528
   04520 Adherens junction
    112217528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112217528
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112217528
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112217528
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  SRC family
   112217528
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112217528
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    112217528
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 112217528
NCBI-ProteinID: XP_024233630
LinkDB
Position
18
AA seq 593 aa
MMGCVQCKDKEATKLTDDRDTSISQSAAGYRYGADPTPQHQHYPSFGVTAIPNFNNFQAP
VGQGITVFGGVHTSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFRKGEKFQIINSTE
GDWWDARSLTTGGNGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLFTGNPRGTYLIR
ESETTKGAFSLSIRDWDDVKGDHVKHYKIRKLDSGGYYITTRAQFETLQQLVQHYSERAA
GLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMESADGLCFN
LTGVCVNCTPDTMGLTHDSWEIARDSLEFEVKLGAGCFAEVWCGTWNGTTKVAVKTLKPG
TMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMGKGSLLDFLKDGEGRGLKL
PNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDNLVCKIADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYR
MPCPQDCPISLHELMVQCWKKDAEERPTFEYLQAFLEDYFTATEPQYQPGDNL
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgatgggctgtgtgcaatgcaaggataaagaagcaaccaaactcacggacgaccgagac
accagcatctcccagagtgccgcaggctaccgctatggagccgaccccacgccacaacac
cagcactaccccagcttcggggtcaccgccatcccaaacttcaacaacttccaggcaccc
gttggccaggggataacggtttttggaggggtccacacctcctcccacacagggacactc
cgcacccgtggcggaacaggagtcaccctctttgtggcactttacgactacgaggcccgg
acagaggacgacctcagcttcaggaaaggggagaagtttcagattatcaacagcactgaa
ggggactggtgggatgctcgttccctcaccaccggtggaaatggctacattcccagtaat
tacgtggctccagtggactccatccaggctgaggactggtactttgggaaactgggccgg
aaggatgcagagaggcaacttctgttcactggcaatccccgcggcacgtatctcatcagg
gagagtgaaaccactaaaggtgccttctccctgtccatacgagactgggacgacgtgaag
ggggaccatgtcaagcattataagatccgtaagctggacagcggcggttactacatcacc
actagggctcagtttgagaccctacagcagctggtacagcactactcagagcgggccgcg
gggctgtgctgtcgcttggtggtgccctgccacaaagggatgccccgcctcaccgacctg
tccgtcaaaaccaaagacgtgtgggagatcccgcgggagtcactgcagctcatcaagcgt
ctggggaatgggcagtttggggaggtctggatggagagtgcggatggtttgtgctttaat
ttaacgggtgtgtgtgtgaactgcacccctgatactatgggcctgactcacgattcctgg
gaaatcgccagagactcacttgagttcgaagtaaagctgggggcgggatgttttgctgag
gtgtggtgtggaacgtggaacggcaccactaaggtggcggtgaagactctgaagccgggc
accatgtctcccgagtccttcctggaagaagctcagatcatgaagaagctccggcatgac
aagctggtgcagctctacgccgtggtgtctgaggaacccatctacatcgtcactgagtac
atgggcaaaggaagcctcctggatttcctgaaggatggggagggacgaggactgaaactg
cccaatctggttgacatggcagcccaggtggcagcaggcatggcgtacatcgagaggatg
aactacatccacagagacctgcgctcggctaacatcctggtcggggacaacctggtgtgt
aagatcgccgactttggactggccaggctgattgaggacaacgagtacacagcacggcaa
ggtgctaagttcccgattaagtggacagccccggaggctgcgctgtatggaaagttcacc
atcaagtcagacgtgtggtcgtttggcatcctgctcaccgagctggtcaccaagggacgt
gtaccctacccagggatgaacaaccgggaggtgctggagcaggtggagcgaggctacagg
atgccctgtccccaggactgccccatctccctccacgagctcatggtacagtgctggaag
aaagacgccgaggagaggcccaccttcgagtacctgcaggccttcctggaggactacttc
acggccacggagccgcagtaccagccaggggacaacctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250060
Entry
112250060         CDS       T05605                                 

Definition
(RefSeq) tyrosine-protein kinase Fyn-like isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250060
   04520 Adherens junction
    112250060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250060
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112250060
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112250060
Protein kinases [BR:otw01001]
 Non-receptor tyrosine kinases
  SRC family
   112250060
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112250060
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    112250060
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr SH2 SH3_1 Pkinase SH3_9 SH3_2 SH3_3
Other DBs
NCBI-GeneID: 112250060
NCBI-ProteinID: XP_024275668
LinkDB
Position
5
AA seq 392 aa
MGCVQCKDKEATKLTDDRDTSISQSATGFRYGADPTPQHQHYPSFGVTAIPNFNNFQAPV
GQGMTVFGGVNTSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFRKGERFQIINSTEG
DWWDARSLTTGGNGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLFTGNPRGTYLIRE
SETTKGAFSLSIRDWDDVKGDHVKHYKIRKLDSGGYYITTRAQFETLQQLVQHYSERAAG
LCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVA
VKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMGKGSLLDFLKDG
EGRGLKLPNLVDMAAQVSPDKDVTHSALCLYN
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgggctgtgtacaatgcaaggataaagaagcaacgaaactcacggacgaccgagacacc
agcatctcccagagtgccacaggcttccgctatggcgccgatcccacgccgcagcaccag
cactatcccagcttcggggtcaccgccatccccaacttcaacaacttccaggcgcctgtc
ggccagggaatgaccgtcttcggaggggtcaacacctcctcccacaccgggaccctacgc
acccgtggcggaacaggagtcaccctctttgtggcactttatgactatgaggcgcggaca
gaggacgacctcagcttcaggaaaggggagaggtttcagattatcaacagcactgaaggg
gactggtgggatgctcgttccctcaccaccggtggaaatggttacatccccagtaattac
gtggctccagtggactccatccaggctgaggactggtactttgggaaactaggccggaag
gatgcagagaggcagctgctgttcactggtaacccccgtggcacctatctcatcagagag
agcgaaactacaaaaggtgccttctccctgtccatacgagactgggatgacgtgaagggg
gaccacgtgaagcattataagatccgtaagctggacagcggcggttactacatcaccacc
agggctcagtttgagaccctacagcagctggtacagcactactcagagcgggcagcgggg
ctgtgttgtcgcttggtagtgccctgccacaaagggatgccccgcctcaccgacctgtcc
gtcaaaaccaaagacgtgtgggagatcccacgggagtcactgcagctcatcaagcgtctg
gggaatgggcagtttggggaggtctggatgggaacgtggaacggcaccactaaggtggcg
gtgaagactctgaagccgggcaccatgtctcctgagtccttcctggaagaagctcagatc
atgaagaagctccggcatgacaagctggtgcagctctacgctgtggtgtctgaggaaccc
atctacatcgtcactgagtacatgggcaaaggaagcctcctggatttcttgaaggatggg
gagggacgaggactgaagctgcccaatctggttgacatggcagcccaagtaagccccgat
aaagatgtcactcactcagctctgtgtttatataactga

DBGET integrated database retrieval system