KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217662
Entry
112217662         CDS       T05605                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217662
   04012 ErbB signaling pathway
    112217662
   04370 VEGF signaling pathway
    112217662
   04371 Apelin signaling pathway
    112217662
   04068 FoxO signaling pathway
    112217662
   04150 mTOR signaling pathway
    112217662
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112217662
  09143 Cell growth and death
   04210 Apoptosis
    112217662
   04218 Cellular senescence
    112217662
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217662
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112217662
   04625 C-type lectin receptor signaling pathway
    112217662
  09152 Endocrine system
   04910 Insulin signaling pathway
    112217662
   04920 Adipocytokine signaling pathway
    112217662
   04914 Progesterone-mediated oocyte maturation
    112217662
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112217662
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112217662
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112217662
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112217662
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112217662
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112217662
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 Pkinase_fungal
Other DBs
NCBI-GeneID: 112217662
NCBI-ProteinID: XP_024233876
LinkDB
Position
18
AA seq 487 aa
MASQTRYGFQMSGIGKGVWTGTMQQHLIGEYIKTWRPRYFLLKRDGTFIGYKERPQDVDQ
LETPLNNFSVAPECQLMKTERPKPNTFIIRCLQWTTVIERTFHVESPEDREQWTKAIQEV
ADGLQKQEEERMDSSPDPMDMEMYLTKPKLKVTMHDFEYLKLLGKGTFGKVILVKEKSTG
KYYAMKILKKEVIVAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGG
ELFFHLSRDRVFSEERARFYGAEIVSALDYLHLEKNVVYRDLKLENLMLDKDGHIKITDF
GLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD
HEKLFELILMEEIRFPRTLGPEGKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIEW
QDVYEKKLVPPFKPQVTSETDTRYFDVEFTGQTITITPPGQDDSMESFDSDRRPHFPQFS
YSASGTA
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcttcacaaacgagatatgggtttcagatgagtggcattggtaaaggagtctggaca
ggcaccatgcaacaacacttaataggagagtacataaagacctggagacccaggtatttc
ttgctgaagagagacggtacgttcatcgggtacaaggagcgaccgcaagacgtcgaccaa
ctggagacgccactcaataacttctcagtagcaccagaatgtcagctgatgaagactgag
cgacccaagcccaacacattcatcatccgctgcctacagtggaccactgtcatagaacgc
accttccatgtggagagcccagaggatagggagcagtggacaaaggccatccaggaggtg
gcagatgggctgcagaaacaggaggaggagaggatggactcctcaccagaccccatggac
atggagatgtacctcaccaagcccaaactcaaagtgactatgcacgactttgaatacctc
aaactcttgggaaaaggcacttttgggaaggttatcctggtgaaggaaaagtcaaccgga
aaatactacgctatgaaaatcctcaagaaagaagtgattgtggcaaaagatgaagtagca
cacactctcactgaaaacagagtactgcagaactccaaacaccccttcttaacgggtctg
aagtactccttccagacgcatgaccgcttgtgtttcgtcatggagtacgccaatggagga
gagctgttcttccacctatcacgagaccgtgtgttctccgaggagagggcccggttctac
ggagcggagatcgtgtcggcgctggactacctccacttggagaaaaatgtggtttacagg
gacctgaagctggaaaacctgatgctggacaaagacggccacataaagatcacagacttt
ggcctgtgtaaggagggcatcaaggacggggccaccatgaagaccttctgtgggacacca
gagtatctggcccctgaggtgctggaggacaatgactacggccgtgctgtggactggtgg
ggtcttggtgtggtcatgtatgagatgatgtgcggtcggctgcccttctacaaccaggac
catgagaagctgtttgagctgatcctgatggaagagatccgctttcctagaaccctgggc
cccgagggaaagtccctgctctctggcctgctcaagaaggaccccaagcagaggttaggt
ggagggcctgatgacgccaaggagataatgcagcacaagttctttgctgggatcgagtgg
caagatgtgtacgagaagaagctggtcccgccattcaagccccaggtcacctcggaaaca
gacacccgctattttgacgtggagttcaccgggcagaccatcaccatcactcctccagga
caagatgacagcatggagtctttcgacagcgacaggagaccccacttccctcagttctcc
tactctgccagtgggacagcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224566
Entry
112224566         CDS       T05605                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112224566
   04012 ErbB signaling pathway
    112224566
   04370 VEGF signaling pathway
    112224566
   04371 Apelin signaling pathway
    112224566
   04068 FoxO signaling pathway
    112224566
   04150 mTOR signaling pathway
    112224566
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112224566
  09143 Cell growth and death
   04210 Apoptosis
    112224566
   04218 Cellular senescence
    112224566
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224566
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112224566
   04625 C-type lectin receptor signaling pathway
    112224566
  09152 Endocrine system
   04910 Insulin signaling pathway
    112224566
   04920 Adipocytokine signaling pathway
    112224566
   04914 Progesterone-mediated oocyte maturation
    112224566
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112224566
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112224566
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112224566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112224566
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112224566
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112224566
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 112224566
NCBI-ProteinID: XP_024243956
LinkDB
Position
25
AA seq 480 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERDEWTEAIQIVADKLQRQEEERIQCS
PTSQMDNIGELEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKANGKYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMGHSFFTGIEWQDVYDKKLI
PPFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgtcaaagaaggctgggtgcaaaaaaggggagaatatatcaag
aactggagaccacgctacttcctgctgaaaacggacggttcgttcataggttacaaagag
aaaccacaggacgcagacctaccttatccccttaataacttctctgttgcaaaatgccaa
ctgatgaagacagaacgaccaaagcccaacacattcatcatcagatgtctacaatggacc
accgtcatagagaggaccttccatgtggacacgccagaggaaagggatgagtggacggag
gcgatccagatagtagcagacaaactccaaagacaggaggaagagaggatccaatgcagt
cccacgtctcagatggacaacatcggagagctggaggagatggacacctctaccagccac
cataaacggaagacaatgaatgactttgactacttaaaactactgggaaaaggcacattt
ggtaaagtgattctagtgagagagaaggctaacgggaaatattatgcaatgaagattttg
aagaaagaagtaattattgcaaaggatgaagtggcacacacactcacagagagcagagta
ttaaaaaacaccaggcaccctttcctaacttctttgaagtattccttccagactaaagac
cgcctgtgctttgtaatggaatatgtgaatggaggagagctgtttttccatttgtcgaga
gagcgggtgttctctgaggaccgcacacgcttctacggtgccgaaatagtctccgctctg
gactacctgcactccgccaagattgtgtaccgggatctcaagctggagaacctaatgcta
gacaaagacggacacgtcaaaatcacagacttcgggctctgcaaggaaggaatcacagat
gctgctacaatgaagactttctgtggaacgccggagtacctagctccagaggtgctggag
gacaatgactacggccgggcagtggactggtggggcctgggcgtggtcatgtatgagatg
atgtgcggtcggctgcccttctacaaccaggaccacgagaagctgtttgagctcatcctc
atggaggacatcaagttcccccgcacgctgtcgtcagacgccaagtcactgctgtcagga
ctactcatcaaggaccccaacaaaagacttggaggaggtccagatgatgctaaagaaatc
atgggacatagtttctttactggaatcgagtggcaagatgtttatgataagaagctgata
ccgcccttcaaacctcaggtgtcgtcagagacagataccaggtattttgacgaagaattc
acggcacagacaattacaataactccccctgaaaaatttgatgaagacgggatggattgc
atggacaacgagcggagaccacacttcccccagttctcctactcggccagtgggagagaa
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225150
Entry
112225150         CDS       T05605                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112225150
   04012 ErbB signaling pathway
    112225150
   04370 VEGF signaling pathway
    112225150
   04371 Apelin signaling pathway
    112225150
   04068 FoxO signaling pathway
    112225150
   04150 mTOR signaling pathway
    112225150
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112225150
  09143 Cell growth and death
   04210 Apoptosis
    112225150
   04218 Cellular senescence
    112225150
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225150
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112225150
   04625 C-type lectin receptor signaling pathway
    112225150
  09152 Endocrine system
   04910 Insulin signaling pathway
    112225150
   04920 Adipocytokine signaling pathway
    112225150
   04914 Progesterone-mediated oocyte maturation
    112225150
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112225150
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112225150
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112225150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112225150
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112225150
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112225150
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 112225150
NCBI-ProteinID: XP_024244595
LinkDB
Position
26
AA seq 479 aa
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPELSVQSLHPLNNFSVGEC
QLMKTERPKPNTFVIRCLQWTTVIERTFHVESNAEREEWMRAIQAVANGLKVREEEEPMD
LFGSPSDNSSMEEMEVAMSKTRSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMHYAMKI
LRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLS
RDRVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDNDGHVKITDFGLCKEGIT
DGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLAPEGKALLAGLLKKDPKQRLGGGPDDAKDVMSHKFFTSINWQDVVDRKL
TPPFKPQVTSETDTRYFDDEFTAQTITVTPPDKYDNLDCEDPNQPAHFPQFSYSASIRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaatgaggtcagcgtagtccgagaaggatggctccacaagagaggtgagtacattaag
acttggaggccgcgctacttcatcctaaagagtgacggctccttcatcggctacaaagag
aagcctgagctgtccgtccagagcttgcatccgctcaacaacttctcagtgggagaatgc
cagctgatgaagacagagcggcccaagcctaacacattcgttatccgctgcctgcagtgg
acaacagtcatcgagaggaccttccatgtagaaagcaatgcagagagagaggagtggatg
cgtgccatccaggcggtggccaatgggttgaaggtgcgagaggaggaagagcccatggac
ctgtttggctctcccagcgacaacagcagcatggaggagatggaggtggccatgtccaag
acccgctccaaagtgacgatgagtgactttgactacctgaagctgctggggaaaggcaca
tttggcaaggttatcctggtgaaggagaaagccacggggatgcactacgccatgaagatc
ctgcgcaaggaggtcatcatcgctaaggatgaggttgcgcacacggttacagagagcaga
gtgttacagaacacccgtcatcccttcctcacaacactgaaatacgctttccagactcat
gaccgattatgttttgtgatggaatacgccaacggaggagagctcttcttccacctgtct
cgggatcgcgtgttcacggaagaccgggcccgtttctatggcgctgagattgtatctgca
ttggagtacctccactctcgtgatgtggtatacagggacctgaagctggagaatctaatg
ctggacaatgacggacatgttaaaatcaccgactttgggctatgtaaggaaggtatcacg
gatggcgccaccatgaagaccttctgtggcaccccagagtaccttgcaccggaggtgctg
gaggacaatgactacggtcgcgctgtggattggtggggcttgggcgtggtcatgtacgag
atgatgtgcggtcggctgcccttctacaaccaggaccatgagcggctgtttgagctcatc
ctcatggaggagatccgcttcccccggaacctggcccccgagggtaaggcgctgctcgca
ggcctgctcaaaaaggaccccaagcagaggttagggggaggaccagatgatgccaaagat
gtgatgtcccacaagttcttcacctccatcaactggcaggatgtggtagataggaagctg
actccgcccttcaagcctcaggtgacttcggagaccgacacccgctactttgacgatgag
ttcacggcacagaccatcacagtcacacctccagacaagtatgacaatctggactgtgag
gaccccaaccagccagcgcacttcccccagttctcttactccgccagcatacgagagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230362
Entry
112230362         CDS       T05605                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230362
   04012 ErbB signaling pathway
    112230362
   04370 VEGF signaling pathway
    112230362
   04371 Apelin signaling pathway
    112230362
   04068 FoxO signaling pathway
    112230362
   04150 mTOR signaling pathway
    112230362
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112230362
  09143 Cell growth and death
   04210 Apoptosis
    112230362
   04218 Cellular senescence
    112230362
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230362
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112230362
   04625 C-type lectin receptor signaling pathway
    112230362
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230362
   04920 Adipocytokine signaling pathway
    112230362
   04914 Progesterone-mediated oocyte maturation
    112230362
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112230362
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112230362
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112230362
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112230362
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112230362
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112230362
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 112230362
NCBI-ProteinID: XP_024252386
LinkDB
Position
32
AA seq 480 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVADSLAKQEEEGILCS
PTSQIENEVNEEEMDTSTSQHKRKTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
TATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEEIKFPRTLSSDSKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVAIDWQDVYDKKLV
PPFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMGEGDSERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagtgaccaaaacgttgtcaaggaaggctgggttcagaagagaggtgagtacataaag
aattggaggccgcgctacttcctgctgaagacagacggatccttcatcggctacaaagac
aaaccccaggacgcagacctggcctatcccctcaataacttctctgtggcaaaatgtcag
ctgatgaagacagagcggccaaagcccaacacgttcatcatccgctgtttgcagtggaca
acggttattgagaggacattccacgtggacacgcctgatgagagggatgagtgggccgag
gccatccagatggtggccgactccctggccaagcaggaggaggaggggatcctgtgcagc
cccacgtcgcagattgagaatgaggtcaacgaggaggagatggacacctccaccagccaa
cacaaacggaagacaatgaatgactttgactatctgaaactactgggaaaaggcactttt
gggaaagtcattctggtgaaggagaaggcgagcggaacttattacgccatgaagatcctg
aagaaagaagtcatcatcgccaaggatgaagttgctcacaccctcacagaaagcagagtg
ttgaaaaacacccgtcatccattcctaacatctctgaagtactcctttcagaccaaggac
cggttgtgctttgtcatggagtatgtgaacggaggagagctgtttttccatttgtcaaga
gagcgagtgttttccgaggaccgcacccgattctacggagctgagatcgtctccgcttta
gactaccttcactctgccaagatagtgtaccgcgatctgaagctggagaacttgatgctg
gataaagacgggcacgtcaagatcacggacttcggcctctgcaaagagggcatcaccgac
acggccaccatgaagaccttctgcggcacgccagagtacctggctccagaggtgctggag
gacaatgactacggccgggcggtggactggtggggtctgggcgtggtcatgtatgagatg
atgtgcggtcggctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctc
atggaggagatcaagtttccacgcacgctctcctccgactctaagtccctgctctccggc
ctgctcatcaaggaccccaacaaacgactcggtggcggtccagacgatgcgaaggagata
atgcgccacagtttctttgtggctatagactggcaagacgtctacgacaaaaagttggtc
ccccccttcatgccacaggtctcgtcagagacagacacccggtatttcgatgaggagttc
acggcacagacgatcaccatcactcccccggagaaatacgatgaagatgggatgggtgag
ggtgacagcgaacggaggcctcatttcccacaattctcatattcggccagcggacgagag
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250387
Entry
112250387         CDS       T05605                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112250387
   04012 ErbB signaling pathway
    112250387
   04370 VEGF signaling pathway
    112250387
   04371 Apelin signaling pathway
    112250387
   04068 FoxO signaling pathway
    112250387
   04150 mTOR signaling pathway
    112250387
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112250387
  09143 Cell growth and death
   04210 Apoptosis
    112250387
   04218 Cellular senescence
    112250387
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250387
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112250387
   04625 C-type lectin receptor signaling pathway
    112250387
  09152 Endocrine system
   04910 Insulin signaling pathway
    112250387
   04920 Adipocytokine signaling pathway
    112250387
   04914 Progesterone-mediated oocyte maturation
    112250387
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112250387
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112250387
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112250387
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250387
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112250387
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112250387
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Seadorna_VP7 FTA2 Pkinase_fungal
Other DBs
NCBI-GeneID: 112250387
NCBI-ProteinID: XP_024276247
LinkDB
Position
5
AA seq 474 aa
MGEVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDIDQLETPLNNFSVAPE
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVDSPEEREQWTKAIQEVADGLQKQEEERMD
SSPDPMDMEMYLTKPKLKVTMPDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTPDRLCFVMEYANGGELFFHLSRDRVFS
EERARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEI
RFPRTLGPEGKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIEWQDVYEKKLVPPFK
PQVTSETDTRYFDVEFTGQTITITPPGQNDSMESFDSDRRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgggcgaagtagtcattgtgaaggagggatggcttcacaaacgaggagagtacataaag
acttggagacccaggtatttcttgctgaagagcgacggtacgttcattggctacaaggag
cgaccgcaagacatcgaccaactggagacgccactcaataacttctcagtagcaccagaa
tgtcagctgatgaaaacagagcgtcctaagcccaacacattcatcatccgctgcctgcag
tggaccactgtcatagagcgcaccttccacgtggatagccccgaggagagggagcagtgg
acgaaggccatccaggaggtggctgatgggctgcagaaacaggaggaggagaggatggac
tcctcaccagaccccatggacatggagatgtacctcaccaaaccaaaacttaaagtgact
atgcctgactttgaatacctcaagctcttgggaaaaggcacttttgggaaggttatcctg
gtgaaggaaaaagccacaggaaaatactacgctatgaaaatcctcaagaaagaagtgatt
gtggcgaaagatgaagtagctcacacgctcactgaaaacagagtactgcagaactccaaa
caccccttcttaacgggtctgaagtactccttccagacgccggaccgcttgtgtttcgtc
atggagtatgccaatggaggagagctgttctttcacctatcacgagaccgtgtgttctcc
gaggagagggcccggttctacggagcggagatcgtgtcggcgttggactacctccactcg
gagaagaacgtggtttacagggacctgaagctggaaaacctgatgctggacaaagacggc
cacatcaagatcacagactttggcctgtgtaaggagggcatcaaggacggggccaccatg
aagaccttctgtgggacgccagagtacctggcccccgaggtgctggaggacaatgactac
ggtcgtgctgtggactggtggggtctgggtgtggtcatgtatgagatgatgtgtggtcgg
ttgcccttctacaaccaggaccatgagaagctgtttgagctgatcctgatggaggagatc
cgcttccctagaaccctggggcccgagggaaagtccctgctctctggcctgctcaagaag
gaccccaagcagaggttaggtggagggcctgatgacgccaaggagataatgcagcacaag
ttcttcgctgggatcgagtggcaagacgtgtatgagaagaagctggtcccgcccttcaag
ccccaggtcacctcggaaacagacacccgctattttgatgtggagttcaccgggcagacc
atcaccatcacgcctccaggacaaaatgacagcatggagtctttcgacagcgacaggaga
ccccacttcccccagttctcctactctgccagtggaacagcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256640
Entry
112256640         CDS       T05605                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256640
   04012 ErbB signaling pathway
    112256640
   04370 VEGF signaling pathway
    112256640
   04371 Apelin signaling pathway
    112256640
   04068 FoxO signaling pathway
    112256640
   04150 mTOR signaling pathway
    112256640
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112256640
  09143 Cell growth and death
   04210 Apoptosis
    112256640
   04218 Cellular senescence
    112256640
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256640
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112256640
   04625 C-type lectin receptor signaling pathway
    112256640
  09152 Endocrine system
   04910 Insulin signaling pathway
    112256640
   04920 Adipocytokine signaling pathway
    112256640
   04914 Progesterone-mediated oocyte maturation
    112256640
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112256640
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112256640
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112256640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112256640
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112256640
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112256640
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 APH FTA2
Other DBs
NCBI-GeneID: 112256640
NCBI-ProteinID: XP_024285796
LinkDB
Position
8
AA seq 473 aa
MTDVAIVKEGWLHKRGEYIKTWRPRYFLLKTDGTFIGYKERPQHVEALETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIEAVADSLQKEEEEMMDS
SPDPMDMEMYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIQITDFGLCKEGITDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGPEGRSLLSGLLKKDPKQRLGGGQNDAKEIMQHKFFAGIEWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQEDSMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccgatgtggcgatagtgaaggagggatggctgcacaaaagaggagagtacattaag
acctggaggcccaggtattttctactcaagactgatggtacattcataggctacaaggaa
cgaccacaacatgttgaggcacttgaaacgcctttaaataacttctcagtagcacagtgc
cagctgatgaagacggagaggcccaagcccaacacattcatcatccgctgcctgcagtgg
accactgttatcgagcgcaccttccacgtggagacccccgaggagagggaagaatggacg
aaggccattgaggccgtagcagacagtctacagaaagaggaggaggagatgatggactcc
tccccagacccaatggacatggaaatgtacctgaccaaacccagactcaaagtgactatg
cacgactttgaatacctcaaactcctaggaaaaggcacttttggcaaagtgatcctggtg
aaggagaaggccacgggacgctactatgccatgaaaatcctgaagaaggaagtaatcgta
gcgaaagatgaagtggcacacacactcacagaaaaccgagtgctccagaattccaagcat
ccgttcttgacgggcctgaaatactccttccagactcatgaccggttgtgtttcgtcatg
gagtatgcgaacggcggagagctgttcttccacctgtcccgggaccgggtgttttctgag
gagcgggctcggttctatggggcggagatagtgtcagcactggactacctgcatgctgag
aggaacgtggtctacagagacctgaagctggaaaatctcatgctggacaaagacggacac
atacaaatcactgactttggactgtgtaaggaggggatcacagacggggccaccatgaag
accttctgtgggacgccagagtacctggccccagaggttctggaggacaatgactatggc
cgggcggtggactggtggggtctgggcgtggtcatgtatgagatgatgtgtggtaggctg
cccttctacaaccaggaccacgagaagctgtttgagctcatcctcatggaggacatccgt
ttcccacgcaccctgggccctgagggcaggtccctgctctcaggcctgctcaaaaaggac
cccaagcagcggttaggtggtggacagaatgatgctaaagagatcatgcagcacaaattc
tttgctgggattgaatggcaagatgtttatgagaagaagctggtcccgccttttaagccg
caggttacctcagaaacagacacgcggtattttgacgaggagttcacagcacagaccatc
actattacaccgcccggacaagaagacagcatggagtcgtttgacagcgaacggaggccc
cacttcccacagttctcctactctgcgagtgggacagcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261841
Entry
112261841         CDS       T05605                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112261841
   04012 ErbB signaling pathway
    112261841
   04370 VEGF signaling pathway
    112261841
   04371 Apelin signaling pathway
    112261841
   04068 FoxO signaling pathway
    112261841
   04150 mTOR signaling pathway
    112261841
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112261841
  09143 Cell growth and death
   04210 Apoptosis
    112261841
   04218 Cellular senescence
    112261841
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112261841
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112261841
   04625 C-type lectin receptor signaling pathway
    112261841
  09152 Endocrine system
   04910 Insulin signaling pathway
    112261841
   04920 Adipocytokine signaling pathway
    112261841
   04914 Progesterone-mediated oocyte maturation
    112261841
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112261841
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112261841
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112261841
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112261841
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112261841
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112261841
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7
Other DBs
NCBI-GeneID: 112261841
NCBI-ProteinID: XP_024293233
LinkDB
Position
11
AA seq 473 aa
MTDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDAFETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVADGLQKQEEEMMDS
SPDPMDMEMYLTKPRLKVTMDDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERSRFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGHEGRSLLSGLLKKDPKQRLGGGQDDAKEIMQHKFFAGIEWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQEDSMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccgatgtggcgatagtgaaggagggatggctgcacaaaagaggagagtacattaag
acctggaggcccaggtattttctactcaagagtgatggtacattcattggctacaaggaa
cgaccacaagatgttgacgcgtttgaaacccccttaaataacttctcagtagcacagtgc
cagctgatgaagacggagaggcccaagcccaacacattcatcatccgctgcctgcagtgg
accactgtcatcgagcgcaccttccacgtggagacacccgaggagagggaagaatggacg
aaagccattcaggctgtagcagatggcctacagaaacaggaagaggagatgatggactcc
tccccagacccaatggacatggagatgtacctgaccaaacccagactcaaagtgactatg
gacgactttgaatacctcaaactcctcggaaaaggtacttttggcaaagtgatcctggtg
aaggagaaggccacaggacgctactatgccatgaaaatcctgaagaaggaagtgatcgta
gcgaaagatgaagtggcacacacactcacagaaaaccgagtgctccagaattccaagcat
ccgttcttgacaggcctgaaatactccttccagacccatgaccggttgtgtttcgtaatg
gagtatgcgaacggcggagagctgttcttccacctctcccgagaccgggtgttctcggag
gagcggtctcggttctacggggcggagatagtgtcagcgctggactacctgcatgctgag
aggaatgtggtctacagagacctgaagctggaaaatctcatgctggacaaagacggacac
ataaagatcaccgactttggactgtgtaaggaggggatcacagacggggccaccatgaag
accttctgtgggacaccagagtacctggccccagaggttctggaggacaatgattacggt
cgtgcggtggactggtggggtctgggtgtggtcatgtacgagatgatgtgcggtcggctg
cccttctacaaccaggaccacgagaagctgtttgagctcatcctcatggaggacatccgt
ttcccacgtaccctgggtcacgagggcaggtccctgctctccggcctgctcaagaaggac
cccaagcagcggttaggtggaggacaggatgatgctaaggagattatgcagcacaaattc
tttgctgggattgaatggcaagatgtttatgagaaaaagctggtcccgcccttcaagccc
caggttacctcggaaacagatacacggtattttgacgaggagttcacagcacagaccatc
actattacaccgcccggacaagaagacagcatggagtcgtttgacagcgaacggagaccc
cacttcccacagttttcctactctgcgagtggaacagcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265172
Entry
112265172         CDS       T05605                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265172
   04012 ErbB signaling pathway
    112265172
   04370 VEGF signaling pathway
    112265172
   04371 Apelin signaling pathway
    112265172
   04068 FoxO signaling pathway
    112265172
   04150 mTOR signaling pathway
    112265172
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112265172
  09143 Cell growth and death
   04210 Apoptosis
    112265172
   04218 Cellular senescence
    112265172
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265172
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112265172
   04625 C-type lectin receptor signaling pathway
    112265172
  09152 Endocrine system
   04910 Insulin signaling pathway
    112265172
   04920 Adipocytokine signaling pathway
    112265172
   04914 Progesterone-mediated oocyte maturation
    112265172
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112265172
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112265172
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112265172
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265172
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112265172
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112265172
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 112265172
NCBI-ProteinID: XP_024298029
LinkDB
Position
2
AA seq 480 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVADSLAKQEEEGSLCS
PTSQIENEVNEEEMDTSTSQHKRKTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEEIKFPRTLSSDSKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVAVDWQDVYDKKLV
PPFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMGEGDSERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagtgaccaaaacgttgtcaaggaaggctgggttcagaagagaggtgagtacataaag
aactggaggccacgttacttcctgctgaagaccgacggatccttcatcggctacaaagac
aaaccccaggacgcagacctggcctatcccctcaataacttctctgtagcaaaatgtcag
ctgatgaagacggagcggcccaagcccaacacgttcatcatccgctgtttgcagtggacc
acggttattgagaggacattccacgtggacacgcctgatgagagggatgagtgggccgag
gccatccagatggtggctgactccctggccaagcaggaggaggaggggagcctgtgcagc
cccacgtcgcagatcgagaacgaggtcaacgaggaggagatggacacctccaccagccaa
cacaaacggaagacaatgaatgactttgactatctgaaactactgggcaaaggcactttt
gggaaagtcattctggtgaaggagaaggcgagtggaacgtattacgccatgaagatcctg
aagaaggaagtcatcatcgccaaggatgaagttgctcacaccctcacagaaagcagagtg
ttaaaaaacacccggcatccattcctaacctctctgaagtactcctttcagaccaaggac
cggttgtgcttcgtcatggagtatgtaaacggaggagagctgtttttccatttgtcaaga
gagcgagtgttctctgaggaccgcacgcgattctacggagctgagatcgtctctgcttta
gactaccttcactctgccaagatagtgtaccgcgatctgaagctggagaacttgatgctg
gataaagatggacacgtcaagatcacggacttcggcctctgcaaagagggcatcacagac
gcggccaccatgaagaccttctgcggcacgccggagtacctggctccagaggtgctggag
gacaatgactacggccgggcggtggactggtggggtctgggcgtggtcatgtatgagatg
atgtgcggccggctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctc
atggaggagatcaagtttccgcgcacgctctcctctgactccaagtctctgctctccggc
ctgctcatcaaggaccccaacaaacgactcggtggcggtccagacgacgcaaaggagatc
atgcgccacagtttttttgtggcagtagactggcaagacgtctacgacaaaaagttggtc
ccccccttcatgccccaggtctcctcagagacggacacccggtattttgatgaggagttc
acggcacagacgatcaccataactcccccggaaaaatatgatgaagacgggatgggcgag
ggtgacagcgaacggaggcctcatttcccacaattctcgtattcggccagtggacgggag
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265711
Entry
112265711         CDS       T05605                                 

Gene name
akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265711 (akt2)
   04012 ErbB signaling pathway
    112265711 (akt2)
   04370 VEGF signaling pathway
    112265711 (akt2)
   04371 Apelin signaling pathway
    112265711 (akt2)
   04068 FoxO signaling pathway
    112265711 (akt2)
   04150 mTOR signaling pathway
    112265711 (akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112265711 (akt2)
  09143 Cell growth and death
   04210 Apoptosis
    112265711 (akt2)
   04218 Cellular senescence
    112265711 (akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265711 (akt2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112265711 (akt2)
   04625 C-type lectin receptor signaling pathway
    112265711 (akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112265711 (akt2)
   04920 Adipocytokine signaling pathway
    112265711 (akt2)
   04914 Progesterone-mediated oocyte maturation
    112265711 (akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112265711 (akt2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112265711 (akt2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112265711 (akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265711 (akt2)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112265711 (akt2)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   112265711 (akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 112265711
NCBI-ProteinID: XP_024299038
LinkDB
Position
13
AA seq 481 aa
MNDISVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPEMSSDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVESNEEREEWMRAIQAVANGLKMREEEAPM
DVTFGSPSDCSSMEEMEVAMSKSRNKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFH
LSRDRVFTEDRARFYGAEIVSALEYLHSQDVVYRDLKLENLMLDKDGHIKITDFGLCKEG
ITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGQEDAKDVMTHMFFTTINWQDVVER
KLLPPFKPQVTSETDTRYFDDEFTAQTITVTPPDKYHSLDAEDQDQRTHFPQFSYSASIR
D
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgacatcagtgtggtcagagagggctggctccataagaggggagagtacattaag
acgtggaggccgcggtacttcatcctgaagagcgatggctccttcatcggctacaaggag
aaaccagagatgtcgtccgaccacagcctcccacccctcaacaacttctctgtggcagag
tgccagctgatgaagacagaacggcccaggcccaacacgtttgtcatccgctgcctacag
tggaccacagtcatagagcgcaccttccacgtggagagtaacgaggaaagggaggaatgg
atgagggcgatccaagcggtggccaacggcctgaagatgcgagaggaagaggctcccatg
gacgtcacgtttggctcccccagcgactgcagcagcatggaggagatggaggtggccatg
tccaagtcccgcaacaaagtgaccatgagtgactttgactacctgaagctgctagggaag
ggaacgtttggcaaggtgatcctggtgaaggagaaggccacaggaatgtactacgccatg
aagatcctgaggaaagaagtcatcatcgctaaggatgaggtagcacacacagtaacagaa
agcagagtccttcagaatacaaggcatcccttcttaacgacactgaaatatgcgttccaa
acacatgaccggctatgctttgtgatggaatatgcaaacggaggagagctgttctttcac
ttgtcgcgagaccgtgtgttcacagaagaccgggcacggttctacggtgcggagattgtg
tctgcgctggagtacctccactcacaggacgttgtctacagggacctgaagctggagaac
ttaatgctggataaagatggacacataaagatcacagattttggactgtgtaaagaggga
atcacagacggggctaccatgaagaccttttgtgggactccagaataccttgcacctgag
gtattagaggacaatgactacggccgagcggtggactggtggggcctgggtgtggtcatg
tatgagatgatgtgcggtcgactgcccttttacaaccaggaccacgagcggttgtttgag
ctcattctcatggaggagatccgcttccccaagaacctggcccccgaagccaaggccctg
cttgctggcctgctcaaaaaggaccccaagcagaggcttggaggtggacaagaagatgcc
aaagacgtgatgactcatatgttcttcaccaccatcaactggcaggatgtggtagagagg
aagctcttgcctcccttcaagccccaggtgacgtcagagacggacacgcgatactttgac
gatgagttcacggcacagaccatcaccgtaacgcccccggacaagtaccacagcttagat
gcagaagaccaggaccagcgcacacacttccctcagttctcttactccgccagcatacgg
gactga

DBGET integrated database retrieval system