KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217736
Entry
112217736         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: F-box only protein 25-like
  KO
K10305  F-box protein 25/32
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112217736
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112217736
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     112217736
SSDB
Motif
Pfam: Elongin_A
Other DBs
NCBI-GeneID: 112217736
NCBI-ProteinID: XP_024234001
LinkDB
Position
18
AA seq 363 aa
MPFLGQDWRSPGWSWIKTEDGWKRIEFYGNELRDNNNGIDLEELCDENKENLFTGNVCEV
VAKKRKKDFYNNNTKSQFIYQEKWIYVQKESTRERHGYCTLGEAFNRLDFSSATQDIQRF
TYVAKLLQLIARSQLPSLSGAAQKNYFNVLEKIVRKGERDGEGYFWRPSXPSPFKELLQD
LSSTLCILTRAXGKSVLVGNINIWVCRLETILNWQQQLNNLQIPKQMSNGMTLRDLPLDM
QNNILYKFSDACDIINLGQATPTLHMLSEDRHLWKKLCQFHFAEKQFCRHLILSERGHVD
WKVMYYTLQKYYPKREQYGDTLHFCRHCSILFWKDSGHPCTANDPNNCLVPVSPQHFIDL
FKF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcctttcttgggccaggactggaggtcgccaggatggagctggatcaagaccgaggat
ggctggaagaggatcgagttctatggaaatgaattgagggacaacaacaacggaatagac
ttggaagagctctgcgatgaaaacaaagagaatctgtttactggaaatgtgtgcgaggta
gttgccaaaaagaggaaaaaagacttctacaataacaacaccaaatcacagtttatttac
caggagaagtggatctatgttcagaaggagagcacaagagagagacatggatactgcacg
ctaggggaagccttcaaccgtctagatttttccagtgccactcaggacatccagagattt
acctatgtggcaaaactcctccagctcatagccaggtctcagctgccatccctcagtgga
gcagctcaaaagaactacttcaacgtgctggaaaagatcgtacggaagggtgagcgagac
ggagagggatatttctggaggccatcataaccctcgcctttcaaggagctgctgcaggac
ctgagctccaccctgtgcatcctgacccgggcanntggcaagtctgtcctggtgggcaac
atcaacatctgggtctgcaggctggagaccatcctcaactggcagcagcagctcaacaac
ctgcagatacccaagcaaatgtccaatgggatgacgctgcgtgacctgccgctagacatg
cagaacaacatcctgtacaagttctccgacgcctgtgacatcatcaacctgggacaggcc
acgcccactcttcacatgctcagtgaggaccggcacttgtggaagaagctgtgccagttt
cactttgcagagaaacagttctgcaggcatctgatcttgtcagagaggggccatgtggac
tggaaggtcatgtactacaccctacagaaatactaccccaagagagagcagtacggagac
acactgcacttctgcagacactgtagcatcctcttctggaaggactctggacatccttgt
acagccaacgatcccaacaactgcctcgtgcctgtttcacctcagcacttcatagacctc
ttcaaattctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246765
Entry
112246765         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: F-box only protein 25-like
  KO
K10305  F-box protein 25/32
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112246765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112246765
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     112246765
SSDB
Motif
Pfam: Elongin_A
Other DBs
NCBI-GeneID: 112246765
NCBI-ProteinID: XP_024271063
LinkDB
Position
Unknown
AA seq 363 aa
MPFLGQDWRSPGWSWIKTEDGWKRIEFYGNELRDNNNGIDLEELCDENKENLFTGNVCEV
VAKKRKKDFYNNNTKSQFIYQEKWIYVQKESTRERHGYCTLGEAFNRLDFSSATQDIQRF
TYVAKLLQLIARSQLPSLSGAAQKNYFNVLEKIVRKGERDGEGYFWRPSXPSPFKELLQD
LSSTLCILTRAXGKSVLVGNINIWVCRLETILNWQQQLNNLQIPKQMSNGMTLRDLPLDM
QNNILYKFSDACDIINLGQATPTLHMLSEDRHLWKKLCQFHFAEKQFCRHLILSERGHVD
WKVMYYTLQKYYPKREQYGDTLHFCRHCSILFWKDSGHPCTANDPNNCLVPVSPQHFIDL
FKF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcctttcttgggccaggactggaggtcgccaggatggagctggatcaagaccgaggat
ggctggaagaggatcgagttctatggaaatgaattgagggacaacaacaacggaatagac
ttggaagagctctgcgatgaaaacaaagagaatctgtttactggaaatgtgtgcgaggta
gttgccaaaaagaggaaaaaagacttctacaataacaacaccaaatcacagtttatttac
caggagaagtggatctatgttcagaaggagagcacaagagagagacatggatactgcacg
ctaggggaagccttcaaccgtctagatttttccagtgccactcaggacatccagagattt
acctatgtggcaaaactcctccagctcatagccaggtctcagctgccatccctcagtgga
gcagctcaaaagaactacttcaacgtgctggaaaagatcgtacggaagggtgagcgagac
ggagagggatatttctggaggccatcataaccctcgcctttcaaggagctgctgcaggac
ctgagctccaccctgtgcatcctgacccgggcanntggcaagtctgtcctggtgggcaac
atcaacatctgggtctgcaggctggagaccatcctcaactggcagcagcagctcaacaac
ctgcagatacccaagcaaatgtccaatgggatgacgctgcgtgacctgccgctagacatg
cagaacaacatcctgtacaagttctccgacgcctgtgacatcatcaacctgggacaggcc
acgcccactcttcacatgctcagtgaggaccggcacttgtggaagaagctgtgccagttt
cactttgcagagaaacagttctgcaggcatctgatcttgtcagagaggggccatgtggac
tggaaggtcatgtactacaccctacagaaatactaccccaagagagagcagtacggagac
acactgcacttctgcagacactgtagcatcctcttctggaaggactctggacatccttgt
acagccaacgatcccaacaactgcctcgtgcctgtttcacctcagcacttcatagacctc
ttcaaattctag

DBGET integrated database retrieval system