KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217801
Entry
112217801         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112217801
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112217801
  09143 Cell growth and death
   04218 Cellular senescence
    112217801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112217801
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112217801
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 112217801
NCBI-ProteinID: XP_024234103
LinkDB
Position
18
AA seq 668 aa
MAEIPTPSPLHELDVAIDPDFEPQKRPRSCTWPLPRPESNAGKPESNDTDIIPEEEDDEE
EQHATSMAINVNGTSSSVGADHQNSNSPTAEGLLSGLENGGSPLSSHSPTTTSGALGTSG
PGSQTPRKSSSRRNAWGNLSYADLITKAIESTPDKRLTLSQIYDWMVRCVPYFKDKGDSN
SSAGWKNSIRHNLSLHSRFIRVQNEGTGKSSWWMINPEGGNGGKAPRRRAVSMDNSNKYT
KSARGRAAKKKAALQAVAAGEGGGDSPSGLSKWPGSPTSRSSEELDAWTDFRSRTNSNAS
TLSGRLSPILANPELDELLDDEPPLSPMLYSSPGEALSPGNTPTPNGKGLPTELPRLADL
AGTMNLNEGLTDDLMDELLDNIALAPTPTGPATQRGSSGLSFGSKLAGLGSSSPTTSPST
PSPSNGAGGGGYCNSIFGPLTVGSSLRPAPMQTIQENKQTSFSCISRFGSQTLQDLLSSE
GHSHSNVMMTQSDPLMSQASAAAVISQNSRRGFVLRSDPMMTFGTTALGQGVLLHNHNQG
SLRTLNGGPSLNNEANSLANAKQQLLHSPLGLGSNGSSMMQIDSSLFLNGSVGGSGGICS
LGPDRFPTDLDLDMFNGSLECDMESIIRNELMDADGLDFNFDSLTNLNGPNLGSFTSTKQ
GPQSWVPG
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccgagatcccaactcccagtcctctccatgagttggacgtggccatagacccagac
ttcgagccacaaaaacggccaagatcgtgcacctggccgttgccccgacccgagtccaat
gcggggaaaccagaaagcaacgacactgacattatacccgaagaagaggatgatgaagag
gaacaacatgccacttccatggccatcaacgtcaatggcaccagctccagcgtgggagca
gaccaccagaacagcaacagccctacggccgaaggactgctgtctggactggagaacgga
ggctccccgctctcctcccactcccccacgaccacttcgggcgcactcggcaccagcggc
ccgggttcgcagactccacggaagtcttcgtcgcgcaggaacgcgtgggggaatctatca
tatgctgatctgataaccaaagccatagagagcacgccggacaagagattgactctgtct
cagatttatgactggatggtgagatgtgtgccgtacttcaaagacaaaggcgacagcaac
agttcggctgggtggaagaactccatccggcacaacctctccctccacagtcgtttcatc
cgtgtccagaacgagggaacgggaaagagttcctggtggatgataaacccggagggaggy
aayggrgggaaggccccccggcgccgtgctgtctccatggacaacagcaacaagtacacc
aagtctgcccgcggccgcgcagccaagaagaaggcggccctccaggcagtggcggcaggc
gaggggggcggagacagcccctcagggctttccaagtggccgggcagccccacatcacgg
agcagtgaggagctggatgcctggacagacttccgctcacgcaccaactccaacgccagc
acgctgagtgggcgcctctcacccatcctggccaacccagagctggacgagctgctggac
gatgagccgccactatcgcccatgctctactccagtcccggcgaggcactgtcgcctggg
aacacccccacgcccaatgggaagggactgcccacagagctgcctcgcctggcagacctg
gcgggcaccatgaacttgaacgaggggctgacggacgacctaatggatgagctgctggat
aacatcgccctggcccccaccccaactggaccagccacccaaagaggatcctccgggctc
agctttggctccaagcttgccggactgggctcctcctccccaaccacctctccctctact
ccatccccctctaatggtgcaggcggcggtggctactgtaactccatctttggtcccctc
acagtaggctcctccctgcggcccgcccccatgcagaccatccaggagaacaagcagacg
tccttctcctgcatctcccgcttcgggagccagaccctgcaggatctgctcagctcagag
ggccacagccacagcaacgtcatgatgacccagtctgacccactgatgtcacaagccagt
gccgccgctgttatctcccagaactccaggcgaggctttgttctccgcagcgaccccatg
atgacctttgggaccacagcgttaggacagggggtgctcctgcacaaccacaaccagggc
tccctgaggacactgaatgggggtccgagcctgaacaacgaggccaacagcctggccaac
gccaagcagcagctcctgcactctccactgggacttggatcaaacggctcctccatgatg
cagattgactcgtccctcttcctgaacgggagcgttggtggaagcggtgggatctgctca
ctaggccctgaccgcttcccaaccgacctggacctggacatgtttaacgggagcctggag
tgtgacatggagtccatcatcagaaacgagctgatggacgcagatggcctggactttaac
tttgactccctgaccaacctgaacggacccaatctgggcagctttaccagcaccaagcag
ggaccccagagctgggtccctggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218371
Entry
112218371         CDS       T05605                                 

Gene name
foxo1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112218371 (foxo1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112218371 (foxo1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112218371 (foxo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112218371 (foxo1)
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112218371 (foxo1)
SSDB
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg
Other DBs
NCBI-GeneID: 112218371
NCBI-ProteinID: XP_024234870
LinkDB
Position
19
AA seq 741 aa
MADLPLPQQLVDIDPDFEPLSRPRSCTWPLPRPEFIEPACSNTSSPAPSVKQEPVEYISN
LSFLEESEDYPEDQKPLVLCNDFQCQGNCIHPQQEKQHPQQLQHHQQHPCPQLPHQQQVP
PVSSPNGSNSVAAAAAVQRKSSSSRRNAWGNMSYADLITKAIESSLEKRLTLSQIYDWMV
KSVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFVRVQNEGTGKSSWWMLNPEGGKSGKSPR
RRAASMDNNSKFTKSRGRAAKKKVALQDGVVGGADSPGGSQYSKWLGSPNSHSHSNDDFE
AWTTFRTRASSDASTLSGRRSPFLEQDIDLSEADIHMGYPGGMGPKITSMATLPSLSEVG
LAGSMGGHHHGHHGTENVMESLLDNLNLLSPKNQGQLVVCGGPGSGPDSSRSSPSSMLQN
SPYSSPSMNPQPQQQDYRKCLYGQAGPGMNSPHLSPIPMQTLPESKPPGSFAHFRSHYNC
PAGLLKELLTSEVADPRGGGGGEAMPTMETVVSQSGRGRGGGGRMLPNYSSQGQVGQVGG
HGGVKMMSPPPQQHTRHPQSHTQNPHPHPHMQPFHSQGQCPPPSGPSMNGCGLIPLTSLN
HAGGPARLASLRTHIHQLQQRPHSGGGHPVSGHHNHSHHHNGAPPPSYSSSANGYGRPGP
GPSSAHPQSHHHHHHHHHQERLPSDLDDMSIERFECDMESVLHDTLMDGDSLDFNFDPMV
TTQGFSQGVGVKTTTHSWVSG
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcagatttaccgctgccgcaacagttggttgacatagacccagatttcgagccactc
tcgaggccccggtcatgcacctggcctctgcctcgaccagagttcatcgaacccgcctgc
tcaaacacatcttcaccggcgccttcagtcaaacaggagcctgtcgaatacatcagtaac
ctcagttttttagaagagtcagaggactacccggaggatcagaaaccgctcgttttgtgc
aatgattttcagtgccaggggaactgcatacacccgcagcaggagaaacaacatccacag
cagttacagcatcatcagcagcacccgtgtcctcagctgccgcaccagcaacaggttccc
ccggtctcatcccccaacgggtcgaattcggtggccgccgccgcagccgtgcagaggaaa
agcagctcgtcgcgtcggaacgcgtgggggaatatgtcctacgcggacctcatcaccaag
gcgatagagagctcactggagaagcgactcaccttgtctcagatctatgactggatggtg
aagagcgtgccatattttaaggataaaggagacagtaatagctcagcaggttggaagaat
tccatccgccacaacctgtccctccacagtcgttttgttcgtgtgcagaacgaggggaca
gggaagagctcgtggtggatgctgaaccccgagggagggaagagcgggaagtccccccga
cgtagagctgcctccatggacaacaacagcaagttcaccaagagcagaggacgggctgcc
aagaagaaggtggctctccaggacggggtagttgggggtgcagacagcccgggaggctcc
cagtactccaagtggctcggcagccccaactcccacagccacagcaatgatgacttcgag
gcctggactaccttccggacgcgtgcctcctccgacgcctccaccctctctggccgtcgc
tctccctttctggaacaggacatcgacctatcagaggccgacatccatatgggctaccct
ggagggatggggcctaagattacctccatggccaccctgcccagcctatcagaagtgggc
ctggccggctccatggggggtcatcatcatggtcaccacggaacagagaatgtcatggag
agtctccttgacaatctcaacctgctgtcccccaagaatcaaggccagctggtggtatgt
ggcgggcctgggtctgggcccgactcctcacggtcctccccctcctccatgcttcagaac
agcccctatagctccccctccatgaacccccaaccccaacagcaggactacaggaagtgc
ctctatggccaggctgggccaggcatgaacagcccacatctctcccccatccccatgcag
acgctgccagagagcaagcctccagggtcctttgcacacttccggagccattacaactgc
cctgctgggctccttaaggagctgctgacctctgaagtagctgacccccgtggtgggggt
ggtggggaggccatgcccaccatggagacagtagtgtcccagtcagggagagggcgagga
ggaggagggcggatgctgcccaactacagcagccaggggcaggtgggacaggtggggggg
cacggaggggtgaagatgatgagtccccctcctcagcaacacacacgacaccctcagtcc
cacactcaaaatccacaccctcacccacatatgcagcctttccacagccagggccagtgc
cctcccccatctgggccctccatgaacggctgtggcctgattcccctgaccagcctcaac
cacgctgggggccctgcccgtctagccagcctcaggacacacatccaccagctacagcag
cggccccacagtggtggtggtcacccagtctcaggccatcacaaccacagtcaccaccac
aacggagctcctccacccagctacagcagcagtgctaatggttatgggagaccaggtcca
ggtcccagctctgctcatccccagtcccaccaccaccatcatcatcatcatcatcaggag
aggctgcctagtgatctagacgacatgtccatcgagaggtttgagtgtgacatggagtct
gttcttcatgacacgctgatggacggagactcgttggacttcaactttgaccccatggtg
accactcaggggtttagtcagggggttggggtgaagaccaccacacacagctgggtgtct
ggctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220917
Entry
112220917         CDS       T05605                                 

Gene name
foxo4
Definition
(RefSeq) forkhead box protein O4
  KO
K12358  forkhead box protein O4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220917 (foxo4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112220917 (foxo4)
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112220917 (foxo4)
SSDB
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg SAND
Other DBs
NCBI-GeneID: 112220917
NCBI-ProteinID: XP_024238659
LinkDB
Position
21
AA seq 617 aa
MEGSTVPTIDPDFEPQSRPRSCTWPLPRPDISAVKPEGADGPESSAGTPPADDDKQEQQQ
IISEPEKVVVTEGGVVAGVGGATPRKGSSRRNAWGNQSYADLISQAIENSPEKRLTLAQI
YDWMVKTVPYFKDKGDSNSSAGWKNSIRHNLSLHNKFLRVHNESTGKSSWWMLNPEGGKT
GKAPRRRAASMDNSSKLLKSRMRAKQTKKAAAGLGGTTGGDGDGGADSPNSSQQFPKWGV
NSGSPSSRGSLDEPDMWTSFRPRTSSNASTLSGRLSPIGPGQEDEDDLPEEGLLGYSTGN
LPPTLTETLMEELDLIDGLTLMTEQQGGASPSTAPPAPPTPLPSASTLLPRGSGFPSFRQ
LQPSNISQAPNQTGGQSSGTQCGNNNNSKPLNYGNSLFNPMPSPGSHGTGLYGTHVPSSL
EALLTSDSPPPSDFMMTQVDPLMPSPGVVGMMGMGVVGGRSKPNQLLLGKGLEPNTVASM
RMQSQLQQQHSQLGLGMILSGMAQDSPQLSALKAQHAQLPGLGPHHGGGLSNVGGGLPGM
GQFGTPSSFLPSQDRLPTDLDIEMFTENLDCDVDYIINSDLMDGEGIDFNFDPIVPGGQS
YSGPATTQSAAHNWVPS
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggagggttcgacggtacccacgattgacccagattttgagccgcaaagcagacctagg
tcgtgcacatggccgctccccagacccgacatctcagctgtcaaaccggagggggcggac
ggccctgaatcttctgcgggaaccccgcccgccgacgacgataagcaggagcaacagcaa
atcatatccgagcctgagaaagttgtggtcacagagggaggagttgtagccggagtaggt
ggagccacaccccgaaagggatcatcccggcgcaatgcatgggggaaccagtcttacgcg
gacctgattagtcaggctattgagaactctccagagaagcgtctaaccttggcacagata
tatgactggatggtgaaaactgtgccttacttcaaagataaaggagatagcaacagctca
gcagggtggaagaattcaattcgccacaacttatcactccacaacaagttcctgagagtt
cacaatgagtccacaggcaagagttcttggtggatgctcaacccagaggggggcaagact
gggaaagccccccgtcgccgtgctgcctccatggacaacagcagcaaactgctgaaaagc
cggatgcgagccaagcagaccaagaaggcagcagcaggcctgggcgggaccactggggga
gatggcgacgggggcgcagacagtcccaactcctcccagcagttccccaaatggggggta
aacagcggcagcccctcatcccgtggtagcctagacgaacctgacatgtggaccagcttc
cgtccacgcaccagctccaatgccagcaccctgagtggccggctgtcccccatcggcccc
gggcaggaggatgaggatgacctgcctgaggaaggtctactgggctactccacgggcaac
ctgccccccaccctcactgagacactaatggaggagctggacctgatcgatggcctgaca
ctgatgaccgagcagcagggaggggctagtcccagcacagccccaccggctccccccacc
cctctgccctctgcctcaacactgcttccccggggctctgggttcccctccttccgtcag
ctacagccatccaacatctcccaggcccccaaccagactgggggacagtcctcaggcaca
caatgtggcaacaataacaactccaaaccattaaactatggtaactctctctttaacccc
atgcccagccctggctcccatgggactggtctctatggcactcatgttccctccagcttg
gaggcgttgctcacctcggactccccgcctcccagtgatttcatgatgacccaggtggac
ccccttatgcccagtcctggtgtagtggggatgatgggcatgggggtggtgggagggcgg
tccaaaccaaaccagctgttgctggggaaggggcttgagccaaacactgtggcatccatg
aggatgcagtcccagctccaacagcagcactctcagctgggcctgggcatgatcctgtca
ggcatggcccaagactctccacagctctcagccctcaaagctcagcatgcacagctgcca
ggtttggggcctcaccacggagggggcctatccaatgtaggaggaggtctgccagggatg
ggccagttcggaacgccgagctccttcctaccaagtcaagaccgcttgcccaccgacttg
gacattgagatgttcacagagaacttggactgtgacgtggactacatcatcaacagtgac
ctcatggatggagagggcattgatttcaactttgaccccatagtgccaggtgggcaaagc
tactctggccctgcaactacgcagagcgccgcccacaactgggtacccagctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223107
Entry
112223107         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O6-like
  KO
K17847  forkhead box protein O6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112223107
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112223107
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112223107
SSDB
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg
Other DBs
NCBI-GeneID: 112223107
NCBI-ProteinID: XP_024241836
LinkDB
Position
23
AA seq 724 aa
MLMMEDDELAHQVDIDSDFEPQSRPRSCTWPLPCPEDFPEVQEVNGGLPLTTIKVEPDDN
LTVSACRAGRMGGTPTELKHPAVAPAPIRATHPCLASAALDVTGQLRKAKSSRRNAWGNQ
SYADLITRAIESTPEKRLTLSQVYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRF
IRVQNEGTGKSSWWMLNPEGGKMGKAPRRRTVSMDNNTKYLKSKGRVSRKRVGRPGIGSG
AQVGLQASPEQGSPPGKVLPGNIGGAGGVEGEFDAWTELHSRASSSTSTLSGRVSPILAE
GELEESEESGLSCSASPHLYPSPSSSARSPAMGAVGGHCPPVEQLPQLANLTGAISLEER
LLEEGYHHHHPHLAAGHKLPPVYHYNPGVKGQGSYCGAVYSQAGMGMLRHHSPMQTIQEN
KPASFCGTLPAYSGTNALQSLLTGGPGGPQQYCAKDIILVQERDAQPMMGPSTNGVSSTR
HSHHPGHNGHAAHSHNSHNGTQSHNLNPVTNHNHSSPHLGHNLSQNHSNHTTHTPTRAPA
LAPRISGGHLQPYSHKVPYLYSPPSHAHLPASTTLPPNPAGMLGMPQDSCHLATAPHPSH
PCHNTYPSPQHQGMGSGLYHHQLGMVGGCTGGSYHGSSYHQPHPHERLPADLDLDIFHGS
LDCDVESILLHDIMDSGEEMDFNFDSSLAQGLGIGMGMGVGLGMGMSGLAGPQQAHNNQS
WVPG
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgttgatgatggaggacgacgaattggctcatcaggttgatatcgattcggatttcgag
ccgcaaagccggcctcgctcgtgcacttggccactgccttgtccggaggatttccccgaa
gtgcaggaggtcaatgggggtcttccactgaccaccatcaaggtggaaccagatgacaat
ctaaccgtttcagcgtgcagagcggggagaatgggtggcacgccgacggagctgaagcat
ccagcagtcgccccggctcccatccgggcgacgcacccatgcttggccagcgcggcactt
gatgtgactggacaattgcgcaaagccaaatcctcgcggcggaacgcatggggtaaccag
tcgtacgcggaccttatcacacgagccattgaaagcacccctgaaaaaagactcacgctt
tcacaggtctatgattggatggtccgctatgttccctatttcaaggataagggcgacagt
aatagttcagctggatggaagaactccattcgacacaacctgtccctccacacgcgcttc
atccgggtgcagaacgaaggcacgggcaagtcctcctggtggatgctcaaccctgagggg
ggcaagatgggaaaggcacctcgccggcgaaccgtctccatggacaacaacaccaagtac
ctgaagagcaagggccgggtcagccgcaagagggtgggcaggccagggattggttctgga
gctcaagtggggctccaggcttcccctgagcagggtagcccaccggggaaagttctccca
ggcaacatagggggagctggtggtgtggaaggagagtttgacgcctggacggagctccac
tcccgggctagttcgtctacgtcgaccctgagcgggcgtgtgtcgcccatcctggccgag
ggcgagctggaggagtcagaggaaagcgggctgtcctgctcggcctcgccacacctctac
ccctccccctcctccagtgcccgctcccctgccatgggggccgtgggaggccactgtcca
cccgtggagcagcttccccagctggctaatctcaccggggcaatcagcctggaggagagg
ctcttggaggaaggctaccaccatcatcatcctcacctggcagcgggccacaaactcccc
ccggtctatcattacaaccctggggttaaaggtcaggggtcgtactgcggcgcggtctac
agccaggctgggatgggcatgctgcgccaccactcgcccatgcagaccatccaggagaat
aagccggctagcttctgcggcaccttgccggcctactcagggaccaacgccctgcagagc
ctgctgacagggggccctggagggccacagcagtactgtgccaaggacataatactggtc
caggagagagatgcccaaccaatgatggggccctccacgaacggagtgagctccacccgt
cacagccaccaccccggacacaatggacatgcagctcacagccacaacagccacaacgga
actcagagtcataacctcaaccctgtgaccaaccacaaccacagctctcctcatcttggc
cacaacctcagtcagaaccacagcaaccacacaacgcacacaccgactcgagccccagcc
ctggccccacgcatcagcggtggccacctccagccctacagccacaaagtcccctatctt
tacagccccccgtcccacgcccacctccccgcttccaccaccctgccacccaacccggcc
ggcatgctggggatgccccaggactcctgccacctggccaccgccccccacccctcacac
ccctgccacaacacttaccccagcccccaacaccagggaatgggcagtggactgtaccac
caccaactgggcatggtgggaggctgcacaggaggcagctaccatggtagctcgtaccac
cagcctcacccccacgagagactaccagccgatctggacctggatatcttccacgggagc
ttggactgcgacgtggagtccatcctcctccacgatatcatggactccggagaggaaatg
gactttaactttgacagctccctggcgcaggggttgggcatcgggatgggcatgggggtg
ggccttgggatgggcatgagtggactggcaggccctcagcaagcccacaacaaccagagc
tgggtgcccggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228186
Entry
112228186         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O1-A-like
  KO
K07201  forkhead box protein O1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112228186
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112228186
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112228186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112228186
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112228186
SSDB
Motif
Pfam: FOXO-TAD FOXO_KIX_bdg
Other DBs
NCBI-GeneID: 112228186
NCBI-ProteinID: XP_024249067
LinkDB
Position
30
AA seq 556 aa
MWSEAPYEWCDTIAKPPEARPPEARCSAKRKKEGALPTAVLYGKRGDREELWWMLNPEGG
KSGKSPRRRAASMDNNSKFTKSRGRAAKKKVALQVDGGADSPGGFQYSKWLGSPNSHSHS
NDDFEAWTTFRTRTSSDASTLSGRRSPFLEQEVDLSEADIHMGYPGGVGPKMTSMATLPS
LSEVGLVDSMGGHHHGHHGTENVMDSVLDNLNLLSPKNQTQLGVGGGPGSGPDSSRSSPS
SKLQNSPYSSPSMTPHPQPQQQDYRKCHYGQAGPGMNSPHLSPIPMQTLQESKSPGSFAP
FLSHYNCPAGLLKELLTSDVADPCCGGEAMPSMETVVSQSGRGRGGRMLPNYSSQGQVGG
HGGVKIMSPPPQQHPQHPQSHPHPHPRPLHSQGPPPSGPSMNSCGLIPLTSLNHAGGPAR
LASLRTHIHQLQQQPRGGGHPASGHQNHSPHHSGAPPPSYGSSANGYVRPGPGHGHSSGH
PQAHHHHQYHNHHQERLPSDLDDMSIERFECDMESVLHDTLMDGDSLDFNFDPMVTSQGF
SQGVGVKTTTHSWVSG
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtggtcggaggcgccgtacgaatggtgtgacacaattgcgaagcctccagaggccagg
cctccagaggcccgctgctcggcgaagcgcaagaaagagggggccctgccaacagcggtc
ttgtatgggaaacgaggggacagggaagagctctggtggatgctgaaccccgagggaggg
aagagcgggaagtccccccgacgtagagctgcctccatggacaacaacagcaagttcacc
aagagcagaggacgggctgcaaagaagaaggtggctctccaggtggatgggggcgcagac
agcccgggaggcttccagtactccaagtggctcggcagccccaactcccatagccacagc
aacgacgactttgaggcctggaccaccttccggacgcgcaccagctccgacgcctccacc
ctctctggccgtcgttctcccttcttggaacaggaggtcgacctatcagaggccgacatc
cacatgggctaccccggaggggtggggcctaagatgacctccatggccaccctgcctagc
ctatcagaggtgggcctggtcgactccatgggtggtcatcaccacggtcaccacggaaca
gagaacgtgatggatagcgtccttgacaacctcaacctgctgtcccccaagaatcaaacc
cagctgggggtaggcggtggtcctgggtctgggcctgactcctcccggtcctctccctcc
tccaagcttcagaacagcccttatagctccccttccatgacccctcacccccagccccaa
cagcaggactataggaagtgccactacggccaggccgggccagggatgaatagcccacat
ctctctcccatccccatgcagactctgcaagagagcaagtcgccagggtccttcgcaccc
ttcctgagccattacaactgccctgctgggctactcaaggagctgttgacctctgacgta
gccgacccttgttgtggtggggaggccatgccctccatggagactgtagtgtcccagtct
gggagaggaagaggagggcggatgcttcccaactacagcagccaggggcaggtagggggg
cacgggggggtgaagataatgagtcccccacctcagcaacacccacagcaccctcagtca
catcctcaccctcacccgcggcccctccacagccagggccctcccccctctgggccctcc
atgaacagctgtggcctgattcccctgaccagcctgaaccacgccgggggcccagcccgt
cttgctagcctcaggacacacatccaccagctacagcagcagccacgtggtggtggtcac
ccagcctcaggccaccaaaaccacagtccccaccacagcggagctcctccacccagctac
ggcagcagtgctaatggttatgtgaggccaggtccaggccacggccacagctctggtcat
ccccaggctcaccatcaccaccaatatcacaaccatcatcaggagaggctgcctagtgat
ctagacgacatgtccatagagaggttcgagtgtgacatggagtctgttcttcatgacacg
ctgatggacggagactcgctggacttcaactttgaccccatggtaacctctcaggggttc
agtcagggggttggggtgaagaccaccacacacagctgggtgtctggctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231941
Entry
112231941         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K17847  forkhead box protein O6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112231941
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112231941
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112231941
SSDB
Motif
Pfam: Forkhead FOXO_KIX_bdg FOXO-TAD
Other DBs
NCBI-GeneID: 112231941
NCBI-ProteinID: XP_024254512
LinkDB
Position
3
AA seq 735 aa
MLMMGDDELAHQVDSDFEPQNRPRSCTWPLPCPEDFPEVLEVNGGLPLTTIKVEPDDNLA
VSACRAGRMGGTPTELKHPAVAPAPIGATHPCLAGAALDVTGQLRKAKSSRRNAWGNQSY
ADLITRAIESTPEKRLTLSQVYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIR
VQNEGTGKSSWWMLNPEGGKMGKAPRRRTVSMDNSTKYLKSKGRVSRKRVGRPGIGSGAQ
VGLQASPEQGSPPGKVLPGNIGGAGSVEGEFDAWTELHSRASSSTSTLSGRLSPILAEVE
LEESEEGGLSCSASPHLYPSPSSSARSPAMGAAGSHCPPVEQLPQLANLTGAISLEERLL
EEGYHHHHPHPAAGHKLPPVYHYNPGVKGQGSYCGAVYSQAGMGMLHHHSPMQTIQENKP
ASFGGTMRAYSGTNALQSLLTGGPGVPQQYCAKDIILGQERDDHPMMGPSTNGVSSTRHS
HHSGHNGHAAHSHNGSHTNHNSAHTHNGHNGTQSRNLNPVTNHNHNSPHLGHNLSQNHSN
HTTHTPTQAPAPALAPRISSGHLQPYSHKAPYLYSPPSHAHLPASTTLPPNPAGMLGMPQ
DSCHLATAPHPSHPCHNTYPSPQHQGMGSGLYHHQRGMVGGGTGGSYHGSSYHQPHPHER
LPADLDLDIFHGSLDCDVESILLHDIMDSGEEMDFNFDSSLAQGVGFGMGMGVGVGMSGL
AGPQQAHNNQSWVPG
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgttgatgatgggggacgacgaattggctcatcaggttgattcggatttcgagccgcaa
aaccggcctcgctcgtgcacttggccactgccttgtccggaggatttccccgaagtactg
gaggtcaatgggggtcttccactgaccaccatcaaggtggaaccagatgacaatcttgcc
gtttcagcgtgcagagcggggagaatgggtggcacgccgacggagctgaagcatccagca
gtcgcccctgctcccatcggcgcgacgcacccatgcttggccggcgcggcacttgatgtg
actggacaattgcgcaaagccaaatcctcgcggcggaacgcatggggtaaccaatcgtac
gcggaccttatcacacgagccattgaaagcacccctgaaaaaagactcacgctatcacag
gtctacgattggatggtccgctatgttccctatttcaaagataagggcgacagtaatagt
tcagctggatggaagaactccatccgacacaacctgtccctccacacgcgcttcatccgg
gtgcagaacgaaggcacgggtaagtcctcctggtggatgctcaaccctgaggggggcaag
atgggcaaggcccctcgccggcgaaccgtctccatggacaacagcaccaagtacctgaag
agcaagggccgggtcagccgcaagagggtgggcaggccggggattggttctggggctcaa
gtggggctccaggcttcccctgagcaaggtagcccaccggggaaggttctcccaggcaac
atagggggagctgggagtgtggaaggagagtttgacgcctggacggagctccactcccgg
gctagttcatctacttcgaccctgagcgggcgcctctcgcccatcctggccgaggtcgag
ctggaggagtcagaggaaggcgggctctcctgctcggcctcgccccacctctacccctcc
ccctcatccagcgcccgttccccggccatgggggccgcgggaagccactgtccacccgtg
gagcaattgccccagctggctaatctcacgggggcgatcagcctggaggagaggctcctg
gaggaaggctaccaccatcatcatcctcacccagcggcaggccacaaacttcccccggtc
tatcattacaaccctggggttaaaggtcaggggtcgtactgcggcgcagtctacagccag
gctgggatgggcatgctgcaccaccactcacccatgcagaccatccaggagaataagcct
gctagcttcggcggcaccatgcgggcctactcagggaccaacgccctgcagagcctgctg
acaggaggccccggagttccacagcagtactgtgccaaggacataatactgggccaggag
agagatgaccaccccatgatggggccctccacgaacggagtgagctccacccgtcacagc
catcactccggacacaacggacatgcagcacacagtcacaatggcagccacacaaaccac
aactcggctcacacccacaacggccacaacggtactcagagtcgtaacctcaaccctgtg
accaaccacaaccacaactctcctcatcttggccacaacctcagtcagaaccacagcaac
cacacaacgcacacaccgactcaagccccagccccagccctggccccacgcatcagcagt
ggccacctccagccctacagccacaaagccccctatctttacagccccccgtcccacgcc
cacctccccgcttccaccaccctaccacccaacccggccggcatgctggggatgcctcag
gactcctgccacctggccaccgccccccacccctcgcacccctgccataacacttacccc
agcccccaacaccaaggaatgggcagtggactgtaccaccaccaacggggcatggtggga
ggtggcacaggaggcagctaccatggtagctcataccaccagcctcacccccacgagaga
ctaccagctgatctggacctggatatcttccacgggagcttggactgcgacgtggagtcc
atcctcctccacgatatcatggactccggagaggaaatggacttcaactttgacagctct
ttggcccagggggtggggttcgggatggggatgggcgtgggggtgggcatgagtggactg
gcaggtcctcagcaagcccacaacaaccagagctgggtgcccggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232993
Entry
112232993         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112232993
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112232993
  09143 Cell growth and death
   04218 Cellular senescence
    112232993
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112232993
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112232993
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 112232993
NCBI-ProteinID: XP_024256103
LinkDB
Position
Unknown
AA seq 669 aa
MAEVPAPSIHTELDVAIDPDFEPQKRPRSCTWPLPRPESNSGKPESNDTDIIPEEDDDEE
EQHATSMAINLNGTSSSLGADDQNSNSPTAEGLLSRQENGGSPLPSQSPTATSGTVSTSS
PGAQTARKSSSRRNAWGNLSYADLITKAISSTPDKRLTLSQIYEWMVRCVPYFKDKGDSN
SSAGWKNSIRHNLSLHSRFIRVQNEGTGKSSWWMINPEGGNGGKAPRRRAVSMDNSNKYT
KSARGRAAKKKAALQAVAAGEGGGDSPSGLSKWPGSPTSRSSEDLDAWTDFRSRTNSNAS
TLSGRLSPILANPELDEVPDDEPPLSPMLYSSPGRVLSPGNAPTPNGKAVPAELPRLADL
AGTMNLNDGLADDLMDELLDNITLAPNPTGPTTQRGSTGFSFGSKPAGLGSTSSAASPSA
ASPSNGASSGGYNNSIFGPLAAGSSLRPAPMQTIQENKQTSFSCISRFGSQTLQDLLNSE
GHSHSDVMMTQSDPLMSQASAAAVISQNSRRGLMLCSDPMMSFGTPVAGQGGQGGLLHPL
NHNQGSLRTLNGGLSLNNEANAKQQLLHSPLRLGSNGSSMMQIDSSLFLNGSAGGSGGIC
SLGPDRFPTDLDLDMFNGSLECDMESIIRNELMDADGLDFNFESLANLNGANLGSFTSTK
QGPQNWVPG
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggccgaggttccagcccccagcattcacactgagttggacgtggccatagacccagac
ttcgagccacaaaaacggccacgatcgtgcacatggccgttgccccgacccgagtccaat
tctggcaaaccagagagcaacgacactgacattatacctgaggaagacgatgatgaagag
gaacaacatgccacttccatggccatcaacctcaatggcaccagctccagcctgggagca
gacgaccagaacagcaacagccctactgccgaaggactgctgtccagacaggaaaatgga
ggctccccgctcccctcccagtcccccacggccacttctggcacagtcagcaccagcagc
ccgggggcgcagactgcacggaagtcctcgtcgcgcagaaacgcgtgggggaatctctca
tatgctgacctgataaccaaagccataagcagcacgccagacaagagattgactctgtct
cagatttatgagtggatggtgagatgtgtgccgtacttcaaagacaaaggtgacagtaac
agctcagctgggtggaagaactccatccggcacaacctctccctccacagtcgtttcatc
cgtgtccagaacgagggaacgggaaagagttcctggtggatgataaacccggagggaggy
aayggrgggaaggccccccggcgccgtgctgtctccatggacaacagcaacaagtacacc
aagtctgcccgcggccgcgcagccaagaagaaggcggccctccaggcagtggcggcaggc
gaggggggcggagacagcccctcagggctttccaagtggccgggcagccccacatcacgg
agcagtgaggacctggatgcctggacagacttccgctcacgcaccaactccaacgccagc
acgctgagtgggcgcctctcgcccatcctggccaacccagagctggacgaggtgccggac
gatgaaccgccgctgtcgcccatgctatactccagccctggcagggtgctgtcgcccggg
aacgcccccacacccaatgggaaggcagtacccgcagagctgcctcgcttggcagacctg
gcaggaaccatgaacctgaacgacgggctggcggatgacctgatggatgagctgctggat
aacattactctggcccccaacccaaccggaccgaccacccagagaggatccactgggttc
agctttggctccaagcctgctgggctgggctccacctcctcagccgcctctccctccgct
gcatccccctctaatggtgcaagcagcggcggctacaataattccatcttcgggcccctc
gcagcgggttcctccctgcggcccgcccccatgcagaccatccaggagaataagcagacg
tccttctcctgcatctcccgctttggcagccagaccttgcaggacctgctcaactcagag
ggccacagccacagcgatgtcatgatgacccagtccgatccgctgatgtcacaggccagc
gccgccgccgtcatctcccagaactcccggcgaggcctcatgctctgcagcgaccccatg
atgtcctttgggaccccggttgctggacagggagggcagggaggtctcttgcaccctctc
aaccacaaccagggctccctcaggaccctgaacgggggtctgagcctgaacaacgaggcc
aacgccaagcagcagctcctgcactctccactgagacttggatccaacggatcctctatg
atgcagattgattcgtctctcttcctgaacgggagcgctggtggcagtggtgggatctgc
tcgctaggccccgaccgctttcccactgacctggacttggacatgtttaatgggagcctg
gagtgtgacatggagtccatcatcagaaatgagctgatggacgcagatggcctggacttt
aactttgagtctctggccaacctgaacggagccaaccttggcagcttcaccagcaccaag
cagggacctcagaactgggtccctggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233533
Entry
112233533         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K17847  forkhead box protein O6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112233533
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112233533
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112233533
SSDB
Motif
Pfam: Forkhead FOXO_KIX_bdg FOXO-TAD
Other DBs
NCBI-GeneID: 112233533
NCBI-ProteinID: XP_024257008
LinkDB
Position
3
AA seq 735 aa
MLMMGDDELAHQVDSDFEPQNRPRSCTWPLPCPEDFPEVLEVNGGLPLTTIKVEPDDNLA
VSACRAGRMGGTPTELKHPAVAPAPIGATHPCLAGAALDVTGQLRKAKSSRRNAWGNQSY
ADLITRAIESTPEKRLTLSQVYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIR
VQNEGTGKSSWWMLNPEGGKMGKAPRRRTVSMDNSTKYLKSKGRVSRKRVGRPGIGSGAQ
VGLQASPEQGSPPGKVLPGNIGGAGSVEGEFDAWTELHSRASSSTSTLSGRLSPILAEVE
LEESEEGGLSCSASPHLYPSPSSSARSPAMGAAGSHCPPVEQLPQLANLTGAISLEERLL
EEGYHHHHPHPAAGHKLPPVYHYNPGVKGQGSYCGAVYSQAGMGMLHHHSPMQTIQENKP
ASFGGTMRAYSGTNALQSLLTGGPGVPQQYCAKDIILGQERDDHPMMGPSTNGVSSTRHS
HHSGHNGHAAHSHNGSHTNHNSAHTHNGHNGTQSRNLNPVTNHNHNSPHLGHNLSQNHSN
HTTHTPTQAPAPALAPRISSGHLQPYSHKAPYLYSPPSHAHLPASTTLPPNPAGMLGMPQ
DSCHLATAPHPSHPCHNTYPSPQHQGMGSGLYHHQRGMVGGGTGGSYHGSSYHQPHPHER
LPADLDLDIFHGSLDCDVESILLHDIMDSGEEMDFNFDSSLAQGVGFGMGMGVGVGMSGL
AGPQQAHNNQSWVPG
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgttgatgatgggggacgacgaattggctcatcaggttgattcggatttcgagccgcaa
aaccggcctcgctcgtgcacttggccactgccttgtccggaggatttccccgaagtactg
gaggtcaatgggggtcttccactgaccaccatcaaggtggaaccagatgacaatcttgcc
gtttcagcgtgcagagcggggagaatgggtggcacgccgacggagctgaagcatccagca
gtcgcccctgctcccatcggcgcgacgcacccatgcttggccggcgcggcacttgatgtg
actggacaattgcgcaaagccaaatcctcgcggcggaacgcatggggtaaccaatcgtac
gcggaccttatcacacgagccattgaaagcacccctgaaaaaagactcacgctatcacag
gtctacgattggatggtccgctatgttccctatttcaaagataagggcgacagtaatagt
tcagctggatggaagaactccatccgacacaacctgtccctccacacgcgcttcatccgg
gtgcagaacgaaggcacgggtaagtcctcctggtggatgctcaaccctgaggggggcaag
atgggcaaggcccctcgccggcgaaccgtctccatggacaacagcaccaagtacctgaag
agcaagggccgggtcagccgcaagagggtgggcaggccggggattggttctggggctcaa
gtggggctccaggcttcccctgagcaaggtagcccaccggggaaggttctcccaggcaac
atagggggagctgggagtgtggaaggagagtttgacgcctggacggagctccactcccgg
gctagttcatctacttcgaccctgagcgggcgcctctcgcccatcctggccgaggtcgag
ctggaggagtcagaggaaggcgggctctcctgctcggcctcgccccacctctacccctcc
ccctcatccagcgcccgttccccggccatgggggccgcgggaagccactgtccacccgtg
gagcaattgccccagctggctaatctcacgggggcgatcagcctggaggagaggctcctg
gaggaaggctaccaccatcatcatcctcacccagcggcaggccacaaacttcccccggtc
tatcattacaaccctggggttaaaggtcaggggtcgtactgcggcgcagtctacagccag
gctgggatgggcatgctgcaccaccactcacccatgcagaccatccaggagaataagcct
gctagcttcggcggcaccatgcgggcctactcagggaccaacgccctgcagagcctgctg
acaggaggccccggagttccacagcagtactgtgccaaggacataatactgggccaggag
agagatgaccaccccatgatggggccctccacgaacggagtgagctccacccgtcacagc
catcactccggacacaacggacatgcagcacacagtcacaatggcagccacacaaaccac
aactcggctcacacccacaacggccacaacggtactcagagtcgtaacctcaaccctgtg
accaaccacaaccacaactctcctcatcttggccacaacctcagtcagaaccacagcaac
cacacaacgcacacaccgactcaagccccagccccagccctggccccacgcatcagcagt
ggccacctccagccctacagccacaaagccccctatctttacagccccccgtcccacgcc
cacctccccgcttccaccaccctaccacccaacccggccggcatgctggggatgcctcag
gactcctgccacctggccaccgccccccacccctcgcacccctgccataacacttacccc
agcccccaacaccaaggaatgggcagtggactgtaccaccaccaacggggcatggtggga
ggtggcacaggaggcagctaccatggtagctcataccaccagcctcacccccacgagaga
ctaccagctgatctggacctggatatcttccacgggagcttggactgcgacgtggagtcc
atcctcctccacgatatcatggactccggagaggaaatggacttcaactttgacagctct
ttggcccagggggtggggttcgggatggggatgggcgtgggggtgggcatgagtggactg
gcaggtcctcagcaagcccacaacaaccagagctgggtgcccggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233618
Entry
112233618         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112233618
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112233618
  09143 Cell growth and death
   04218 Cellular senescence
    112233618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112233618
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112233618
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 112233618
NCBI-ProteinID: XP_024257148
LinkDB
Position
Unknown
AA seq 669 aa
MAEVPAPSIHTELDVAIDPDFEPQKRPRSCTWPLPRPESNSGKPESNDTDIIPEEDDDEE
EQHATSMAINLNGTSSSLGADDQNSNSPTAEGLLSRQENGGSPLPSQSPTATSGTVSTSS
PGAQTARKSSSRRNAWGNLSYADLITKAISSTPDKRLTLSQIYEWMVRCVPYFKDKGDSN
SSAGWKNSIRHNLSLHSRFIRVQNEGTGKSSWWMINPEGGKGGKAPRRRAVSMDNSNKYT
KSARGRAAKKKAALQAVAAGEGGGDSPSGLSKWPGSPTSRSSEDLDAWTDFRSRTNSNAS
TLSGRLSPILANPELDEVPDDEPPLSPMLYSSPGRVLSPGNAPTPNGKAVPAELPRLADL
AGTMNLNDGLADDLMDELLDNITLAPNPTGPTTQRGSTGFSFGSKPAGLGSTSSAASPSA
ASPSNGASSGGYNNSIFGPLAAGSSLRPAPMQTIQENKQTSFSCISRFGSQTLQDLLNSE
GHSHSDVMMTQSDPLMSQASAAAVISQNSRRGLMLCSDPMMSFGTPVAGQGGQGGLLHPL
NHNQGSLRTLNGGLSLNNEANAKQQLLHSPLRLGSNGSSMMQIDSSLFLNGSAGGSGGIC
SLGPDRFPTDLDLDMFNGSLECDMESIIRNELMDADGLDFNFESLANLNGANLGSFTSTK
QGPQNWVPG
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggccgaggttccagcccccagcattcacactgagttggacgtggccatagacccagac
ttcgagccacaaaaacggccacgatcgtgcacatggccgttgccccgacccgagtccaat
tctggcaaaccagagagcaacgacactgacattatacctgaggaagacgatgatgaagag
gaacaacatgccacttccatggccatcaacctcaatggcaccagctccagcctgggagca
gacgaccagaacagcaacagccctactgccgaaggactgctgtccagacaggaaaatgga
ggctccccgctcccctcccagtcccccacggccacttctggcacagtcagcaccagcagc
ccgggggcgcagactgcacggaagtcctcgtcgcgcagaaacgcgtgggggaatctctca
tatgctgacctgataaccaaagccataagcagcacgccagacaagagattgactctgtct
cagatttatgagtggatggtgagatgtgtgccgtacttcaaagacaaaggtgacagtaac
agctcagctgggtggaagaactccatccggcacaacctctccctccacagtcgtttcatc
cgtgtccagaacgagggaacgggaaagagttcctggtggatgataaacccggagggaggr
aarggygggaaggccccccggcgccgtgctgtctccatggacaacagcaacaagtacacc
aagtctgcccgcggccgcgcagccaagaagaaggcggccctccaggcagtggcggcaggc
gaggggggcggagacagcccctcagggctttccaagtggccgggcagccccacatcacgg
agcagtgaggacctggatgcctggacagacttccgctcacgcaccaactccaacgccagc
acgctgagtgggcgcctctcgcccatcctggccaacccagagctggacgaggtgccggac
gatgaaccgccgctgtcgcccatgctatactccagccctggcagggtgctgtcgcccggg
aacgcccccacacccaatgggaaggcagtacccgcagagctgcctcgcttggcagacctg
gcaggaaccatgaacctgaacgacgggctggcggatgacctgatggatgagctgctggat
aacattactctggcccccaacccaaccggaccgaccacccagagaggatccactgggttc
agctttggctccaagcctgctgggctgggctccacctcctcagccgcctctccctccgct
gcatccccctctaatggtgcaagcagcggcggctacaataattccatcttcgggcccctc
gcagcgggttcctccctgcggcccgcccccatgcagaccatccaggagaataagcagacg
tccttctcctgcatctcccgctttggcagccagaccttgcaggacctgctcaactcagag
ggccacagccacagcgatgtcatgatgacccagtccgatccgctgatgtcacaggccagc
gccgccgccgtcatctcccagaactcccggcgaggcctcatgctctgcagcgaccccatg
atgtcctttgggaccccggttgctggacagggagggcagggaggtctcttgcaccctctc
aaccacaaccagggctccctcaggaccctgaacgggggtctgagcctgaacaacgaggcc
aacgccaagcagcagctcctgcactctccactgagacttggatccaacggatcctctatg
atgcagattgattcgtctctcttcctgaacgggagcgctggtggcagtggtgggatctgc
tcgctaggccccgaccgctttcccactgacctggacttggacatgtttaatgggagcctg
gagtgtgacatggagtccatcatcagaaatgagctgatggacgcagatggcctggacttt
aactttgagtctctggccaacctgaacggagccaaccttggcagcttcaccagcaccaag
cagggacctcagaactgggtccctggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239895
Entry
112239895         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: forkhead box protein O1-A-like
  KO
K07201  forkhead box protein O1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112239895
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112239895
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112239895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112239895
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112239895
SSDB
Motif
Pfam: Forkhead FOXO_KIX_bdg FOXO-TAD
Other DBs
NCBI-GeneID: 112239895
NCBI-ProteinID: XP_024264049
LinkDB
Position
Unknown
AA seq 541 aa
MSYADLITKAIESTPDKRLTLSQIYDWMVKNVPYFKDKGDSNSSAGWKNSIRHNLSLHSR
FVRVQNEGTGKSSWWMLNPEGGKTGKSPRRRAASMDNNNSKFAKSRGRAAKKKLSLQGGP
DGGADSLGGGTYSKWPGSPNSHSNDDFDAWSGFRPRTSSNASTLSGRLSPFTPEDDLGDG
DVHMGYPGSSGAKMANTLPSLSEMASSLGHHHHSSENVMENLLDNLNLLSPKNTQVGGGG
GVGQGSSQNSPSPLMQASPGSGVGYPSYSSPSMVPQQQPQQQQDYRKCRYSQARMNALSP
MSPNPMQTLGDIKSSFSPSSLGQYNCPAGLLKELLTSDSDPRGDMMPSVDTVVSQSSAGR
SSVLPSYNASQHRGGGGGGRGGSLHPHPHSHPHPHALSHPQTHPHPHLHNQTPPTSVSSM
NSCNLMSLSSLNHSGGGGNGTRLGVKNPMQVPYGLSTHVAPGGMPGGFCPINTNGYGRPG
LGLPPTPHHHHHHLEKLPSDLDDMSIERFECDRNPXLHDTLMDGDPDATNPGDRVGVHPR
G
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtcttatgcggacctcataactaaggctattgagagcaccccggacaagagacttacc
ttgtcgcagatttatgactggatggtgaagaacgtgccttatttcaaggacaagggagat
agcaacagctctgctggatggaagaactctatccggcacaacctgtccctccacagtcgg
ttcgtccgtgtgcagaacgaggggacagggaagagttcctggtggatgctaaaccctgag
ggagggaagactgggaagtcccctcgacgtagagcagcctccatggacaacaacaacagc
aagttcgccaagagcagaggacgggctgctaagaagaagttgtctctccagggtggtcct
gacgggggagcagacagcctcgggggaggcacctactccaagtggcccggcagccccaac
tcccacagcaacgatgactttgatgcatggagcggtttccggccacgcacctcctccaac
gccagcacactcagcggacgcctctcgcccttcacgcccgaggacgacctcggagacggg
gacgtgcacatgggctacccgggatcctccggggccaagatggcgaacacattgcccagc
ctgtcagagatggcgagttctctaggccaccaccaccacagctcagagaacgttatggag
aaccttctggataacctgaacctcctctctcccaagaacacccaggtgggaggaggaggg
ggtgtggggcaggggtcatcccagaactccccttcccccctaatgcaggccagccccggg
tcaggggtgggctacccttcctactcctctccctccatggtcccccagcaacaaccccag
cagcagcaggactaccgcaagtgtcggtacagccaggcaaggatgaatgctctctccccc
atgtcccccaaccccatgcaaaccctgggggacatcaagtccagcttcagcccctcgtct
ctgggtcaatataactgtcctgctggcctcctcaaggagctcctgacctcagactctgac
ccccgcggggacatgatgccctcggtcgacacggtggtctctcagtctagcgcaggacga
agcagcgtactaccttcgtataatgcctctcagcacagaggaggaggaggaggaggaaga
ggggggagtctacacccccatccacactctcaccctcacccccacgccctctctcatccc
caaacccaccctcaccctcacctccacaaccaaaccccacccacttctgtctcgtccatg
aacagctgcaacctgatgtctctgagcagtttgaaccacagtggtggagggggtaacgga
acccgcctgggcgttaagaaccccatgcaggtgccctacggtctctctacccatgttgca
ccaggggggatgcccggtgggttctgccccatcaacactaacggatatgggcgtcccggc
ctgggtctaccccccaccccccaccaccaccaccaccacctggagaaactgcccagtgat
ctggacgacatgtccattgagaggttcgagtgtgataggaatccanntcttcacgacacc
ctgatggacggagacccggacgcaacgaacccgggggaccgcgtgggtgtgcaccccagg
ggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246120
Entry
112246120         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O6-like
  KO
K17847  forkhead box protein O6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112246120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112246120
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112246120
SSDB
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg
Other DBs
NCBI-GeneID: 112246120
NCBI-ProteinID: XP_024270159
LinkDB
Position
Unknown
AA seq 724 aa
MLMMEDDELAHQVDIDSDFEPQSRPRSCTWPLPCPEDFPEVQEVNGGLPLTTIKVEPDDN
LTVSACRAGRMGGTPTELKHPAVAPAPIRATHPCLASAALDVTGQLRKAKSSRRNAWGNQ
SYADLITRAIESTPEKRLTLSQVYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRF
IRVQNEGTGKSSWWMLNPEGGKMGKAPRRRTVSMDNNTKYLKSKGRVSRKRVGRPGIGSG
AQVGLQASPEQGSPPGKVLPGNIGGAGGVEGEFDAWTELHSRASSSTSTLSGRVSPILAE
GELEESEESGLSCSASPHLYPSPSSSARSPAMGAVGGHCPPVEQLPQLANLTGAISLEER
LLEEGYHHHHPHLAAGHKLPPVYHYNPGVKGQGSYCGAVYSQAGMGMLRHHSPMQTIQEN
KPASFCGTLPAYSGTNALQSLLTGGPGGPQQYCAKDIILVQERDAQPMMGPSTNGVSSTR
HSHHPGHNGHAAHSHNSHNGTQSHNLNPVTNHNHSSPHLGHNLSQNHSNHTTHTPTRAPA
LAPRISGGHLQPYSHKVPYLYSPPSHAHLPASTTLPPNPAGMLGMPQDSCHLATAPHPSH
PCHNTYPSPQHQGMGSGLYHHQLGMVGGCTGGSYHGSSYHQPHPHERLPADLDLDIFHGS
LDCDVESILLHDIMDSGEEMDFNFDSSLAQGLGIGMGMGVGLGMGMSGLAGPQQAHNNQS
WVPG
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgttgatgatggaggacgacgaattggctcatcaggttgatatcgattcggatttcgag
ccgcaaagccggcctcgctcgtgcacttggccactgccttgtccggaggatttccccgaa
gtgcaggaggtcaatgggggtcttccactgaccaccatcaaggtggaaccagatgacaat
ctaaccgtttcagcgtgcagagcggggagaatgggtggcacgccgacggagctgaagcat
ccagcagtcgccccggctcccatccgggcgacgcacccatgcttggccagcgcggcactt
gatgtgactggacaattgcgcaaagccaaatcctcgcggcggaacgcatggggtaaccag
tcgtacgcggaccttatcacacgagccattgaaagcacccctgaaaaaagactcacgctt
tcacaggtctatgattggatggtccgctatgttccctatttcaaggataagggcgacagt
aatagttcagctggatggaagaactccattcgacacaacctgtccctccacacgcgcttc
atccgggtgcagaacgaaggcacgggcaagtcctcctggtggatgctcaaccctgagggg
ggcaagatgggaaaggcacctcgccggcgaaccgtctccatggacaacaacaccaagtac
ctgaagagcaagggccgggtcagccgcaagagggtgggcaggccagggattggttctgga
gctcaagtggggctccaggcttcccctgagcagggtagcccaccggggaaagttctccca
ggcaacatagggggagctggtggtgtggaaggagagtttgacgcctggacggagctccac
tcccgggctagttcgtctacgtcgaccctgagcgggcgtgtgtcgcccatcctggccgag
ggcgagctggaggagtcagaggaaagcgggctgtcctgctcggcctcgccacacctctac
ccctccccctcctccagtgcccgctcccctgccatgggggccgtgggaggccactgtcca
cccgtggagcagcttccccagctggctaatctcaccggggcaatcagcctggaggagagg
ctcttggaggaaggctaccaccatcatcatcctcacctggcagcgggccacaaactcccc
ccggtctatcattacaaccctggggttaaaggtcaggggtcgtactgcggcgcggtctac
agccaggctgggatgggcatgctgcgccaccactcgcccatgcagaccatccaggagaat
aagccggctagcttctgcggcaccttgccggcctactcagggaccaacgccctgcagagc
ctgctgacagggggccctggagggccacagcagtactgtgccaaggacataatactggtc
caggagagagatgcccaaccaatgatggggccctccacgaacggagtgagctccacccgt
cacagccaccaccccggacacaatggacatgcagctcacagccacaacagccacaacgga
actcagagtcataacctcaaccctgtgaccaaccacaaccacagctctcctcatcttggc
cacaacctcagtcagaaccacagcaaccacacaacgcacacaccgactcgagccccagcc
ctggccccacgcatcagcggtggccacctccagccctacagccacaaagtcccctatctt
tacagccccccgtcccacgcccacctccccgcttccaccaccctgccacccaacccggcc
ggcatgctggggatgccccaggactcctgccacctggccaccgccccccacccctcacac
ccctgccacaacacttaccccagcccccaacaccagggaatgggcagtggactgtaccac
caccaactgggcatggtgggaggctgcacaggaggcagctaccatggtagctcgtaccac
cagcctcacccccacgagagactaccagccgatctggacctggatatcttccacgggagc
ttggactgcgacgtggagtccatcctcctccacgatatcatggactccggagaggaaatg
gactttaactttgacagctccctggcgcaggggttgggcatcgggatgggcatgggggtg
ggccttgggatgggcatgagtggactggcaggccctcagcaagcccacaacaaccagagc
tgggtgcccggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246612
Entry
112246612         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K17847  forkhead box protein O6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112246612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112246612
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112246612
SSDB
Motif
Pfam: Forkhead FOXO_KIX_bdg FOXO-TAD
Other DBs
NCBI-GeneID: 112246612
NCBI-ProteinID: XP_024270816
LinkDB
Position
Unknown
AA seq 735 aa
MLMMGDDELAHQVDSDFEPQNRPRSCTWPLPCPEDFPEVLEVNGGLPLTTIKVEPDDNLA
VSACRAGRMGGTPTELKHPAVAPAPIGATHPCLAGAALDVTGQLRKAKSSRRNAWGNQSY
ADLITRAIESTPEKRLTLSQVYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIR
VQNEGTGKSSWWMLNPEGGKMGKAPRRRTVSMDNSTKYLKSKGRVSRKRVGRPGIGSGAQ
VGLQASPEQGSPPGKVLPGNIGGAGSVEGEFDAWTELHSRASSSTSTLSGRLSPILAEVE
LEESEEGGLSCSASPHLYPSPSSSARSPAMGAAGSHCPPVEQLPQLANLTGAISLEERLL
EEGYHHHHPHPAAGHKLPPVYHYNPGVKGQGSYCGAVYSQAGMGMLHHHSPMQTIQENKP
ASFGGTMRAYSGTNALQSLLTGGPGVPQQYCAKDIILGQERDDHPMMGPSTNGVSSTRHS
HHSGHNGHAAHSHNGSHTNHNSAHTHNGHNGTQSRNLNPVTNHNHNSPHLGHNLSQNHSN
HTTHTPTQAPAPALAPRISSGHLQPYSHKAPYLYSPPSHAHLPASTTLPPNPAGMLGMPQ
DSCHLATAPHPSHPCHNTYPSPQHQGMGSGLYHHQRGMVGGGTGGSYHGSSYHQPHPHER
LPADLDLDIFHGSLDCDVESILLHDIMDSGEEMDFNFDSSLAQGVGFGMGMGVGVGMSGL
AGPQQAHNNQSWVPG
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgttgatgatgggggacgacgaattggctcatcaggttgattcggatttcgagccgcaa
aaccggcctcgctcgtgcacttggccactgccttgtccggaggatttccccgaagtactg
gaggtcaatgggggtcttccactgaccaccatcaaggtggaaccagatgacaatcttgcc
gtttcagcgtgcagagcggggagaatgggtggcacgccgacggagctgaagcatccagca
gtcgcccctgctcccatcggcgcgacgcacccatgcttggccggcgcggcacttgatgtg
actggacaattgcgcaaagccaaatcctcgcggcggaacgcatggggtaaccaatcgtac
gcggaccttatcacacgagccattgaaagcacccctgaaaaaagactcacgctatcacag
gtctacgattggatggtccgctatgttccctatttcaaagataagggcgacagtaatagt
tcagctggatggaagaactccatccgacacaacctgtccctccacacgcgcttcatccgg
gtgcagaacgaaggcacgggtaagtcctcctggtggatgctcaaccctgaggggggcaag
atgggcaaggcccctcgccggcgaaccgtctccatggacaacagcaccaagtacctgaag
agcaagggccgggtcagccgcaagagggtgggcaggccggggattggttctggggctcaa
gtggggctccaggcttcccctgagcaaggtagcccaccggggaaggttctcccaggcaac
atagggggagctgggagtgtggaaggagagtttgacgcctggacggagctccactcccgg
gctagttcatctacttcgaccctgagcgggcgcctctcgcccatcctggccgaggtcgag
ctggaggagtcagaggaaggcgggctctcctgctcggcctcgccccacctctacccctcc
ccctcatccagcgcccgttccccggccatgggggccgcgggaagccactgtccacccgtg
gagcaattgccccagctggctaatctcacgggggcgatcagcctggaggagaggctcctg
gaggaaggctaccaccatcatcatcctcacccagcggcaggccacaaacttcccccggtc
tatcattacaaccctggggttaaaggtcaggggtcgtactgcggcgcagtctacagccag
gctgggatgggcatgctgcaccaccactcacccatgcagaccatccaggagaataagcct
gctagcttcggcggcaccatgcgggcctactcagggaccaacgccctgcagagcctgctg
acaggaggccccggagttccacagcagtactgtgccaaggacataatactgggccaggag
agagatgaccaccccatgatggggccctccacgaacggagtgagctccacccgtcacagc
catcactccggacacaacggacatgcagcacacagtcacaatggcagccacacaaaccac
aactcggctcacacccacaacggccacaacggtactcagagtcgtaacctcaaccctgtg
accaaccacaaccacaactctcctcatcttggccacaacctcagtcagaaccacagcaac
cacacaacgcacacaccgactcaagccccagccccagccctggccccacgcatcagcagt
ggccacctccagccctacagccacaaagccccctatctttacagccccccgtcccacgcc
cacctccccgcttccaccaccctaccacccaacccggccggcatgctggggatgcctcag
gactcctgccacctggccaccgccccccacccctcgcacccctgccataacacttacccc
agcccccaacaccaaggaatgggcagtggactgtaccaccaccaacggggcatggtggga
ggtggcacaggaggcagctaccatggtagctcataccaccagcctcacccccacgagaga
ctaccagctgatctggacctggatatcttccacgggagcttggactgcgacgtggagtcc
atcctcctccacgatatcatggactccggagaggaaatggacttcaactttgacagctct
ttggcccagggggtggggttcgggatggggatgggcgtgggggtgggcatgagtggactg
gcaggtcctcagcaagcccacaacaaccagagctgggtgcccggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250331
Entry
112250331         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112250331
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112250331
  09143 Cell growth and death
   04218 Cellular senescence
    112250331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112250331
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112250331
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 112250331
NCBI-ProteinID: XP_024276156
LinkDB
Position
5
AA seq 669 aa
MAEVPAPSIHTELDVAIDPDFEPQKRPRSCTWPLPRPESNSGKPESNDTDIIPEEDDDEE
EQHATSMAINLNGTSSSLGADDQNSNSPTAEGLLSRQENGGSPLPSQSPTATSGTVSTSS
PGAQTARKSSSRRNAWGNLSYADLITKAISSTPDKRLTLSQIYEWMVRCVPYFKDKGDSN
SSAGWKNSIRHNLSLHSRFIRVQNEGTGKSSWWMINPEGGKGGKAPRRRAVSMDNSNKYT
KSARGRAAKKKAALQAVAAGEGGGDSPSGLSKWPGSPTSRSSEDLDAWTDFRSRTNSNAS
TLSGRLSPILANPELDEVPDDEPPLSPMLYSSPGRVLSPGNAPTPNGKAVPAELPRLADL
AGTMNLNDGLADDLMDELLDNITLAPNPTGPTTQRGSTGFSFGSKPAGLGSTSSAASPSA
ASPSNGASSGGYNNSIFGPLAAGSSLRPAPMQTIQENKQTSFSCISRFGSQTLQDLLNSE
GHSHSDVMMTQSDPLMSQASAAAVISQNSRRGLMLCSDPMMSFGTPVAGQGGQGGLLHPL
NHNQGSLRTLNGGLSLNNEANAKQQLLHSPLRLGSNGSSMMQIDSSLFLNGSAGGSGGIC
SLGPDRFPTDLDLDMFNGSLECDMESIIRNELMDADGLDFNFESLANLNGANLGSFTSTK
QGPQNWVPG
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggccgaggttccagcccccagcattcacactgagttggacgtggccatagacccagac
ttcgagccacaaaaacggccacgatcgtgcacatggccgttgccccgacccgagtccaat
tctggcaaaccagagagcaacgacactgacattatacctgaggaagacgatgatgaagag
gaacaacatgccacttccatggccatcaacctcaatggcaccagctccagcctgggagca
gacgaccagaacagcaacagccctactgccgaaggactgctgtccagacaggaaaatgga
ggctccccgctcccctcccagtcccccacggccacttctggcacagtcagcaccagcagc
ccgggggcgcagactgcacggaagtcctcgtcgcgcagaaacgcgtgggggaatctctca
tatgctgacctgataaccaaagccataagcagcacgccagacaagagattgactctgtct
cagatttatgagtggatggtgagatgtgtgccgtacttcaaagacaaaggtgacagtaac
agctcagctgggtggaagaactccatccggcacaacctctccctccacagtcgtttcatc
cgtgtccagaacgagggaacgggaaagagttcctggtggatgataaacccggagggaggr
aarggygggaaggccccccggcgccgtgctgtctccatggacaacagcaacaagtacacc
aagtctgcccgcggccgcgcagccaagaagaaggcggccctccaggcagtggcggcaggc
gaggggggcggagacagcccctcagggctttccaagtggccgggcagccccacatcacgg
agcagtgaggacctggatgcctggacagacttccgctcacgcaccaactccaacgccagc
acgctgagtgggcgcctctcgcccatcctggccaacccagagctggacgaggtgccggac
gatgaaccgccgctgtcgcccatgctatactccagccctggcagggtgctgtcgcccggg
aacgcccccacacccaatgggaaggcagtacccgcagagctgcctcgcttggcagacctg
gcaggaaccatgaacctgaacgacgggctggcggatgacctgatggatgagctgctggat
aacattactctggcccccaacccaaccggaccgaccacccagagaggatccactgggttc
agctttggctccaagcctgctgggctgggctccacctcctcagccgcctctccctccgct
gcatccccctctaatggtgcaagcagcggcggctacaataattccatcttcgggcccctc
gcagcgggttcctccctgcggcccgcccccatgcagaccatccaggagaataagcagacg
tccttctcctgcatctcccgctttggcagccagaccttgcaggacctgctcaactcagag
ggccacagccacagcgatgtcatgatgacccagtccgatccgctgatgtcacaggccagc
gccgccgccgtcatctcccagaactcccggcgaggcctcatgctctgcagcgaccccatg
atgtcctttgggaccccggttgctggacagggagggcagggaggtctcttgcaccctctc
aaccacaaccagggctccctcaggaccctgaacgggggtctgagcctgaacaacgaggcc
aacgccaagcagcagctcctgcactctccactgagacttggatccaacggatcctctatg
atgcagattgattcgtctctcttcctgaacgggagcgctggtggcagtggtgggatctgc
tcgctaggccccgaccgctttcccactgacctggacttggacatgtttaatgggagcctg
gagtgtgacatggagtccatcatcagaaatgagctgatggacgcagatggcctggacttt
aactttgagtctctggccaacctgaacggagccaaccttggcagcttcaccagcaccaag
cagggacctcagaactgggtccctggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256219
Entry
112256219         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O4-like
  KO
K12358  forkhead box protein O4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112256219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112256219
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112256219
SSDB
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg SAND
Other DBs
NCBI-GeneID: 112256219
NCBI-ProteinID: XP_024285074
LinkDB
Position
8
AA seq 622 aa
MEDSKVPKIDPDFEPQSRPRSCTWPLPRPDISAVKPEGADGPESAAGTPPADEDKQEQQQ
IVCEPEKVVVSEGGVVAGVGGATPRKGSSRRNAWGNHSYADLISQAIENAPEKRLTLAQI
YDWMVKTVPYFKDKGDSNSSAGWKNSIRHNLSLHNKFLRVHNESTGKSSWWMLNPEGGKT
GKAPRRRAASMDNSSKLLKSRMRAKQTKKAAAGLGGTTGGDGDGVADSPNSSQQFPKWGV
NSGSPSSRGSLDDPDMWTSFRPRTSSNASTLSGRLSPIGPGQEDEDDLPEEGLLGYSTGN
LPPTLTETLMEELDLIDGLTLMTEQQGRASPSTAPMVPSTPLPSASTLLPRGSGFPTFRQ
LQPPNLSQATNQIGGQSSGTQSGNNNNSKPSNYGNSLFNPMPTPGSHGTGHYGTHVGSSL
EALLTSDSPPPSDVMMTQVDPLMPSPGGVGMMGMGGPMVGGRAKPNQLLLGKGLEPNTVA
PMGMQSQLQSQLQQQHSQLGMSLSGMAQDSPQFSGLKAQHAQLPGMGLHHGGGLSANAGG
GLPGMGQFGTPSCFLPSQDRLPTDLDIEMFTENLDCDVDYIINSDLMDGEGIDFNFDPII
QGGQSYSGPATTQSSAHNWVPS
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggaggattcaaaggtacccaagattgacccagattttgagccgcaaagcagacctagg
tcgtgcacatggcctctccccagacccgacatctcagctgttaaaccggagggggcagac
ggacctgaatccgctgcgggaacccctcccgccgacgaggataagcaagagcaacagcaa
atcgtatgtgagcctgagaaagttgtggtctcagagggaggagttgtagccggagtgggt
ggagccacgccccgaaagggatcatcccggcgcaatgcatgggggaaccattcctacgcg
gacctgattagccaggctattgagaacgctccagagaagcgcttaaccttggcacagata
tatgactggatggtgaaaactgtgccttacttcaaagataaaggagatagcaacagctca
gcagggtggaagaattcaattcgccacaatttatcactccacaacaagttcttgagagtt
cacaatgagtccacaggcaaaagttcctggtggatgctcaacccagaggggggcaagact
gggaaagccccccggcgccgtgctgcctccatggacaacagcagcaaactgctaaagagc
cggatgcgggccaagcagaccaagaaggcagcagcaggcttgggcgggaccaccggggga
gacggtgatggtgtcgcagacagtcccaactcctcccagcagttccccaaatggggggtg
aacagcggcagcccctcatcccgcggtagcctagacgaccctgacatgtggaccagcttc
cgtccacgcaccagctccaacgccagcaccctgagtggccggctgtcccccattggtccc
ggccaggaggatgaggatgacctgcctgaggaaggtctactgggctactccacgggcaac
ctgccgccaaccctcaccgagacactcatggaggagctggacctgatcgatggcctgacg
ctgatgacagagcagcaaggaagggctagtcccagcacggcccccatggtgccctccacc
cctctgccctccgcttccaccctgcttccccgggggtccgggttccccacattccgtcag
ctgcagccacccaacctctcccaggccaccaaccagattgggggacagtcctcaggcaca
caatctggcaacaataacaactccaaaccctcaaactatggcaactccctcttcaaccct
atgcctacccccggctcccatgggactggtcactatggcacccatgtaggctccagcttg
gaggcattgctcacttcggactccccgcctcccagtgatgtcatgatgacccaggtggat
ccgctgatgcccagtccgggtggagtggggatgatgggcatgggggggcccatggtggga
gggcgggccaagcccaaccaactgttgctggggaaggggcttgagcccaacactgtggca
cccatggggatgcaatctcaactccagtcccagctccagcagcagcactctcagctgggc
atgagcctgtcaggcatggcccaggactctccacagttctccggcctcaaagcccagcat
gcacagctgccaggtatggggcttcaccacggagggggcctctccgccaatgcaggagga
ggtctgccagggatgggccagttcggaacgccgagctgcttcctgcccagtcaagaccgc
ttgcccaccgacttggatatcgagatgttcacagagaacttggactgtgacgttgactac
atcatcaacagcgacctcatggatggagagggcatcgatttcaactttgaccccataatc
cagggtggccaaagctactccggccctgcgaccacgcagagctccgcccacaactgggta
cccagctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256920
Entry
112256920         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112256920
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112256920
  09143 Cell growth and death
   04218 Cellular senescence
    112256920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112256920
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112256920
SSDB
Motif
Pfam: Forkhead FOXO_KIX_bdg FOXO-TAD SAND
Other DBs
NCBI-GeneID: 112256920
NCBI-ProteinID: XP_024286271
LinkDB
Position
8
AA seq 660 aa
MAEVPHNDIDIDPDFEPQKRPRSCTWPLPRPESNTGKPESNDDIIPEDEEDYVTEPSISS
YTPVNNLNGGITIPQNTNNLSEHQTIPVTTKKEVLTPTSKEEAGSSQTHAITALNGLASQ
PRKSSTRRNAWGNYSYADLITQAIESSPDQRLTLAQIYDWMVRSVTYFKDKGDSNSSAGW
KNSIRHNLSLHSRFMRVHNEGTGKSSWWMVNPEVGKSGKAPRRRAVSMDNGNKLIKGARG
QAAKKASLGLQTFQDGSSESLSLSSSLSKWTGSPTSRSSDELDTWTDFRSRTNSNASTVS
GRLSPILANPELDEALDDDSIAPLYSSPSRLSPSTATLGLGDMALTMNLNDGLPDHLMGD
FLDNISLTASQQPQGQEVESRTNQTGSSVFTYTCPGSSSSLVVPSSGSFGPPGTIFLLSP
PPSSVASLRQSPMQTIQENHQASFSCLSSRFNNHHTLQDQMNLETHGSHVSDVMLTHSDP
MMSQASASVTLSQNSQRNAMLLRKDPMSSSIRDCAAGPNSQTPPVPGWWAQAGLSTPDNE
ILCSSNELAQQANQILQHLPSPSRNYCMQLGGSGTNGRSGSLLQLNAQDHFPIPSDPDLE
VFNSRLDCDIRNELMDADCLGLCFDRSPLRSGTPTTNNLSTAGGFSSSKQTSSSPSWVPS
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggctgaagtaccgcacaatgatattgacatcgatccggacttcgagccccagaaacga
ccgaggtcttgtacctggcctctgcctcgaccggagtccaacacagggaagcccgaatcg
aacgatgacatcatcccggaggacgaggaggattatgtcacagagcccagcatctctagc
tacactcctgtcaacaatttgaatggtggcataactatacctcagaacacaaataactta
tctgaacaccaaaccatccccgtcaccactaagaaagaagtactaaccccaacttcaaaa
gaggaggccgggtcttcacagacgcatgccatcacagctctcaatggcctggcctcccaa
cctagaaagtcctcaactcggaggaatgcctgggggaactactcctatgcggacctcatc
acccaggccatagagagctccccggaccagaggctgacgttagcccagatctatgattgg
atggtgagatctgtcacttacttcaaggacaaaggggacagcaacagctctgcaggctgg
aagaactccatccgacacaacctctctctccacagtcgtttcatgcgggttcataatgaa
ggaacggggaagagttcctggtggatggtcaacccagaggttgggaaaagtggcaaagct
ccacgacgacgggctgtatccatggacaacggcaacaagctgatcaaaggtgctcgaggt
caagccgcgaagaaggcatctctaggcctacagaccttccaagatggcagctccgagagt
ttatctttgtcctctagcctgtccaagtggacaggaagtcccacgtctcgcagcagcgac
gaactggacacctggacagacttcaggtcacgtaccaactccaacgccagcacggtcagt
ggccgcctctcccctatcctggccaacccggaactggacgaggctctggatgacgactcg
atcgcgcccctctactccagtcccagcagattgtccccctccaccgccaccctcggtctg
ggcgacatggcccttactatgaacctcaacgacgggctccctgaccacctgatgggcgac
tttcttgacaacatcagccttacggcgtcccagcagccccaggggcaggaagtggagagc
agaaccaatcagacggggagctcagtgtttacctacacgtgtccaggaagcagcagtagt
ctggtcgtcccgtcctccggcagcttcggccctcccggcaccatcttcctgctcagcccc
ccaccctcctcagtggcctccctacgtcagtcccccatgcagaccatccaggagaaccac
caagcttccttctcctgcctgtcctctcgtttcaacaaccaccacactctgcaagaccaa
atgaacctggagacccatggcagccatgtcagcgacgtcatgctcacacactctgacccg
atgatgtcacaagccagcgcctctgtcactttgtcccagaattcccagcggaatgctatg
cttctccgcaaggaccctatgtcatcatcaatccgggactgtgctgcaggtccaaattca
cagactcccccagtgcccggttggtgggctcaggctggcttgtcaacacctgacaatgaa
atcttgtgctcaagcaatgaattggcccagcaggccaaccagattctccagcacctccca
tctcccagtagaaattattgtatgcagcttggtggctctggtaccaacggcagatctgga
agccttttgcagttgaatgctcaggaccacttcccaataccttcagaccctgatctggag
gtgttcaacagcaggctggactgtgacatacgtaatgagctgatggacgctgactgcctt
ggcttatgttttgaccgctctcccctgcgctctggtactccgaccactaataacttaagt
acagcagggggattctccagctccaaacaaacctcttcttccccaagctgggttccaagc
tag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261501
Entry
112261501         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O3-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112261501
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112261501
  09143 Cell growth and death
   04218 Cellular senescence
    112261501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112261501
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112261501
SSDB
Motif
Pfam: Forkhead FOXO_KIX_bdg FOXO-TAD
Other DBs
NCBI-GeneID: 112261501
NCBI-ProteinID: XP_024292650
LinkDB
Position
11
AA seq 647 aa
MAEVSHNEPLSQDIDIDPDFEPQKRPRSCTWPLPRPESNAGKPESNDDIIPEEEDDDVTA
PSSSSSYTVNNVNGGIAIHQNTKNSSKHPCFTTTTKEEVLNPTSKEEGNDVDGSSLSTQT
HAVSALNGLASQPRKSSARRNAWGNYSYADLITQAIESSPDQRLTLSQIYEWMVRSVPYF
KDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWMVNPEGGKGGKAPRRRAVSM
DNSNKLIKGARGRAAKKKASLGLQAVQDGSSESLSLSSSLSKWTGSPTSRSSDELDAWTD
FRSRTNSNASTISGRLSPILANPELDEALDDDSISPLSPMLYSSPSSLSPSTGPLGLADL
ALTMNLNDGLPDDLMGDLLDNISLTASQQPLGQEVESGGPNQMGSSVLTFSCSGGGSSSL
GIPSSGSYGSAISIFQLSPPSSSVTSLRQSPMQTIQENHQASFSCLSSRFNHHHALQDLL
SLETHGSHVSDIMLTHSDPLMSQASASVTLSQNSRRNAMLLRKDPMMSSNWDGAAGLNSQ
TSLMPGWRAQAGLSTPSNEVLCSSNDLDQQAKQLLQHLPSPSRNSSMQLGGSGTNNSTSE
NPFQLIAPDRFPIPDDLDLDVFNSSLDCDMDTIIRNELMDADCIDDL
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggctgaagtatcacacaatgaaccactctctcaggatattgacatcgatccagacttt
gagccccagaaacgaccaaggtcttgcacctggcctctgcctcgaccagagtccaatgca
gggaagcccgaatcaaacgatgacatcattcccgaggaagaggatgatgatgtcacagca
cccagcagctctagctcgtacactgtcaataatgtgaatggtggcatagccatacatcag
aacacaaagaactcttctaaacacccgtgcttcaccaccaccactaaggaagaagtacta
aaccccacttccaaagaggaggggaatgacgtcgatgggtcctccttgtccacacagacg
catgctgtctcagctctcaatggcctggcctcccaacctaggaagtcctcagctaggagg
aatgcctgggggaactactcctatgcggacctcatcacccaggccatagagagctccccg
gaccagaggctgacattatcccagatctatgagtggatggtgaggtctgtcccttacttc
aaggacaaaggagacagcaacagctctgcaggctggaagaactccatccgacacaacctg
tctctccacagtcgtttcatgcgggtgcagaatgaaggaacggggaaaagttcctggtgg
atggtcaaccctgagggcgggaaaggcggcaaagctccacgacgacgggccgtatccatg
gacaacagcaacaagttgatcaaaggtgctcgaggccgcgccgccaagaagaaggcatct
ctaggcctacaggccgtccaagatggcagctccgagagtttatccttatcctctagcttg
tccaagtggacaggaagtcccacgtctcgcagcagcgacgaactggatgcctggacggac
ttcaggtctcgcaccaactccaacgccagcacaatcagcgggcgcctttcccccatcctg
gccaacccagagctggacgaggcgctggatgacgactccatctctcccctctcccccatg
ctctactccagtcccagcagtttgtccccctccaccggccccctaggtctggccgaccta
gccctcactatgaaccttaatgatgggctccctgacgatctgatgggcgaccttctggac
aacatcagcttgacggcgtcccagcagcccctggggcaggaggtggagagcggaggaccc
aatcagatggggagctcagtgttaaccttcagctgttcaggaggtggtagtagtagtctg
ggcattccatcttccggcagctacgggtctgccatctccatcttccagctcagccccccg
tcctcctcagtgacctccctacgccagtcccccatgcagaccatccaagagaaccaccaa
gcttccttctcctgcctgtcctctcgtttcaaccaccaccacgccctacaggacctgctg
agcctggagacacatggcagccatgtcagcgacatcatgctcacgcactctgacccactg
atgtcacaagccagcgcctctgtcactttgtcccagaattcccggcggaatgccatgctg
cttcgcaaggaccctatgatgtcatcaaactgggacggtgctgcgggtctgaattcccag
acttccttaatgcctggttggcgggctcaggctggcttgtctacaccgagcaatgaagtg
ttgtgctcaagcaatgacttggaccagcaggccaagcagcttctccagcacctaccgtct
cccagtagaaactcttctatgcagcttggtggctctggtaccaacaacagcacctctgaa
aacccatttcagttgatcgctccagaccgctttcccatccctgacgatctggatttggac
gtgttcaacagcagcctggactgtgacatggacactatcatccgtaatgagctgatggac
gctgactgcattgatgatttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264071
Entry
112264071         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein O1-A-like
  KO
K09408  forkhead box protein O3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112264071
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112264071
  09143 Cell growth and death
   04218 Cellular senescence
    112264071
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112264071
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    112264071
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112264071
NCBI-ProteinID: XP_024296440
LinkDB
Position
12
AA seq 209 aa
MAEAAQQPQQVEIDPDFEPLSRPRSCTWPLPRPEFITPGDSNTSSPAPSVKQEPSSNSDF
ISSLSLLEETEDYPEEDQKPTILCNDFQCQENCIHDHQQHQQQHPGNSPQLPQQQVLLLS
SPAGSASSVAAAAAAAAQRKSSSSRRNAWGNMSYADLITKAIESTPDKRLTLSQIYDWMV
KNVPYFKDKGDSNSSAGWKVKRFNTVHYI
NT seq 630 nt   +upstreamnt  +downstreamnt
atggccgaggcagcccaacaaccacaacaggttgagatcgacccggatttcgagcctctt
tcccggccccgctcctgcacatggcccctgccacgtccggagttcatcaccccgggcgac
tccaacacctcctctcccgccccttctgtcaaacaagaacccagcagcaactccgacttc
atctccagcctcagtttattagaagagactgaagattaccccgaagaggatcagaaaccc
accatcctctgcaatgatttccaatgtcaggaaaactgcatccacgaccaccaacagcat
caacagcagcacccggggaacagcccccaactcccgcagcaacaggtgcttttgctctcc
tctccggccgggtctgcatcttcagtagcggctgcggccgctgcagctgcccagaggaaa
agcagttcatctcggcgtaacgcctggggtaatatgtcttatgcggacctcataactaag
gctattgagagcaccccggacaagagacttaccttgtcgcagatttatgactggatggtg
aagaacgtgccttatttcaaggacaagggagatagcaacagctctgctggatggaaggta
aagcgtttcaatacagtacattacatctga

DBGET integrated database retrieval system