KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217822
Entry
112217822         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 5-like isoform X1
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112217822
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217822
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112217822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112217822
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112217822
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112217822
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 112217822
NCBI-ProteinID: XP_024234144
LinkDB
Position
18
AA seq 778 aa
MEHFYWLRGTMNLLPGLSRFSSMFGKKKKRLEISAPSNFEHRVHTGFDAREQKFTGLPQQ
WQSLLADTANRPKPMVDPSYITPIQLAPMKTIVRGNRPPKDASINGLLEEFDSISVTRSN
SLRKESPTGSHQAGAPKPASHHPHPNEENGFSHYYSRYSCDLDTPSRDFSLEPYRKDGKG
FAPDGDWAVGRHYRFPKQNGHLTHATRVPFYPDAMPQKADYAKLPPDYHTYLESKVAGAR
SADEVGSGSGVGSAGGSAGSTTGGYYRASVGGSSSQDYRDASMVGTPSRTSLHSEQINYP
DSEWSYSGVSRDEYEKRPKSSYVRQNSPTPAIRQRSRSGSGLQEPNVPYRASGVFKSPPQ
THPYNSYTYPRLSETLTNSQAMAKGDYDRQSRDGSPQVPGSDTYPRGPLKLPQSHNKPSG
YPPGHLQYPPVFHHYKPSPYHHPPSQPSPPYTPQGAYSQPSSLYIPLGAYPPPSWGSSSD
AQPSRVSHEQFRAALQLVVNPGDPREYLDSFIKIGEGSTGIVCIASEKHSGKQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMN
EEQIATVCVLVLRALSYLHIQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRK
SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPP
RLKESHKVSSVLRAFLGLMLVREPSQRATAQELLQHPFLKLSGPPSCIVPLMRHYRHR
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggagcatttctattggttgagaggaactatgaatctgttaccaggtttgtccaggttt
tccagcatgtttgggaagaagaaaaagaggctggagatttcagctccatctaacttcgag
caccgggtccacacgggtttcgatgcgcgagagcagaagttcactggcctgccccagcaa
tggcagagtctcctggcagacacagccaacaggccgaagcccatggtagacccctcctat
atcacgcccatacagctggctcctatgaagaccatagttcgagggaaccgtcccccgaag
gatgcgtccatcaatggtctcctggaggagttcgacagcatatctgtgacacgttccaac
tccctacgtaaagaaagccctacgggctcccaccaggctggggcccccaaacccgcctcc
caccacccccaccccaacgaggagaacggcttcagccactattactcccgatactcctgt
gacctggacacccccagtagggacttctctctggagccctacaggaaggatggtaaaggc
tttgctccagatggggactgggccgtggggagacactaccgcttccccaaacagaacggc
cacctcacccacgccacccgcgtccccttctacccagacgccatgcctcagaaggccgat
tacgccaagctgcctccggactaccacacctacctggagagcaaggtggcgggggcgcgc
tcggccgacgaggtgggatctgggtccggggtgggcagcgcaggggggtctgccgggtcc
acgacagggggatactaccgggcgtctgtaggtggctcgtccagtcaggactaccgggac
gcgtcaatggtggggacgccgtcccgcacctcgctgcacagcgagcaaatcaactacccg
gacagcgagtggagctacagcggcgtgtccagagatgagtacgagaagaggcccaagtcg
tcgtatgtgaggcagaacagccccacgccggccatcagacagcgctccaggtcggggtct
ggcctccaggagcccaacgtgccctacagagccagcggggtctttaagagtccccctcag
acacacccctacaactcctacacctacccacgcctctcagagacactcaccaactcacag
gccatggccaagggtgattacgaccggcagtcacgagacgggagtccccaggtcccaggg
tctgacacgtacccccgcggtcccctcaaactacctcagagtcacaacaagccctctggc
tatccccccggacacctccagtacccccctgtgttccaccactacaaaccctccccctac
caccacccaccctcacagcccagcccgccatacaccccacagggggcatattcccagcca
tcgtccctctacattcccctgggggcctacccccctccttcctggggctccagttcagac
gcccagccctccagggtctcccacgaacagttcagggccgccctgcagctcgtcgtcaac
ccaggtgaccccagggagtacttggacagtttcattaagattggcgagggctcgacgggc
atcgtgtgcattgccagcgagaagcacagtggcaagcaggtggccgtcaagaagatggac
ttgaggaaacagcagaggagagaactgctcttcaatgaggtggtgatcatgagggactat
caccatgagaacgtggttgacatgtacaacagctacctggtcggagacgagctctgggtc
gttatggagttcctggagggcggggccctgacggacattgtcactcacacgaggatgaat
gaggagcagatagccacagtgtgtgtgttggtgttgagggctctatcgtacctccacata
cagggagtcatccacagagacatcaagagtgattctatcctcctgaccagcgatggacgg
atcaagctgtcagactttggcttctgtgcccaagtgtccaaagaggtgcccaagaggaag
tctctggtgggcacgccctactggatggcaccagaggtcatctcacggttaccctacggc
acggaggtggatatctggtcgttgggcatcatggtgatagagatgatcgatggggaaccc
ccgtactttaacgaaccccctctacaggccatgaggaggatacgagacaacctgccccca
cggctaaaggagtcacacaaggtatcgtcggtgctgagggctttcctgggcctgatgttg
gttagagagccgtctcagcgagccacagcccaggagctgctccagcaccccttcctcaag
ctgtcgggtcccccatcctgcatcgtccccctaatgaggcactaccgccaccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228863
Entry
112228863         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112228863
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228863
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112228863
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112228863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112228863
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112228863
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112228863
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT DUF2052 Kdo Spt5_N CENP-B_dimeris
Other DBs
NCBI-GeneID: 112228863
NCBI-ProteinID: XP_024250337
LinkDB
Position
30
AA seq 571 aa
MSDSVDIEEKPPAPPLRMNSSSRDSSSVNHGSKPLPMAPEEKNKKVRLRSIFPGGDKTNK
KKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLD
VLKFYDSKETVNNQKYMSFTSGDKSAHGYIAVNTLNRLLSSGPPVSHRTCSALFDKGAKT
STEPPIAPPVSEEEEEEEEEEEEDDDDDNELPPVIAPRPEHTKSIYTRSVIEPLAPPAPV
KEVTTPPESQVLPENTSSTLYRNTDRQKKKSKMTDEEILERLRSIVSVGDPKKKYTRFEK
IGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYL
VGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNI
LLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAI
EMVEGEPPYLNENPLRALYLIATNGTPELQNPERLTSVFRDFLNRCLEMDVDRRGSAKEL
LQHSFLKLAKPLSSLSPLIVAAKEAIKNSSR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgtccgatagtgtcgatattgaagagaaaccgccagcccctcccctgagaatgaacagt
agttcccgagactcttcatcagtgaatcacggctccaaacctctcccaatggctcctgaa
gagaagaacaagaaggttcgcctgcgctccatcttccctggaggagacaagacaaacaag
aagaaggagaaggagcgtcctgagatctccctgccctcagactttgagcacaccatccat
gttggttttgacgctgttacaggggagttcactggcatcccagagcagtgggcacgcctc
cttcagacctccaacatcaccaaactggagcagaagaagaaccctcaggccgtgctggac
gtgctcaagttctacgactccaaagagacggtcaacaaccagaaatacatgagtttcacc
tccggagacaaatccgcacatggatacatagcagtcaacactctgaaccgactgctgtcg
tctgggcctcctgtcagccatagaacctgcagcgcattatttgacaagggtgcaaagaca
tccacagagcccccgatagcgccccctgtgtcagaggaggaggaggaggaggaggaagaa
gaggaggaggatgacgatgatgacaatgagcttccgcccgtcatcgcacctcgacctgag
cacactaaatctatatacacccgctctgtcatcgagcccttggcgcctcccgcccctgtg
aaggaggtcacaaccccgccggagtcccaggtcttgccagagaacacatccagcactctg
taccgcaacaccgaccggcagaagaagaagtccaagatgacagacgaggagattctggag
cgactgaggagcattgtgagtgtgggggaccccaaaaagaagtacacacgctttgagaaa
ataggacaaggggcatctggcactgtatacacagccattgacattgctactggccaggag
gtggccatcaagcagatgaacctccagcagcagcccaagaaggagctcatcatcaatgag
atcctggtgatgagggaaaacaaaaaccccaacatagtcaactacctggacagttacctg
gtaggggatgagctgtgggtagtgatggagtacctggctggaggctcactgactgatgtc
gtgactgagacctgcatggatgagggccagattgccgcagtctgcagagagtgtctacag
gctctggactttctgcactccaaccaggtgatccacagagacatcaagagtgacaacatc
ctgctgggcatggacggctcggtcaagctcaccgacttcgggttctgtgcccagatcacc
ccagagcagaacaagcgcagcaccatggtgggcacgccctactggatggcacccgaggtg
gtgacccgcaaggcctacgggcccaaggtggacatctggtccctgggtatcatggccata
gagatggtggagggtgaacctccctacctgaatgagaaccctctcagagcgctgtacctt
atcgccaccaacgggactccagagctccagaaccctgagcgattgacctccgtgttcaga
gacttcctcaaccgttgcctggagatggacgtggaccgcagaggctcagccaaggagctc
ctccagcattcgttcctgaagttagccaagcccctgtccagcctgagccccctgattgtt
gcagccaaggaagccatcaagaacagcagccgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234003
Entry
112234003         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 1-like
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234003
   04012 ErbB signaling pathway
    112234003
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234003
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112234003
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112234003
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112234003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112234003
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112234003
   03036 Chromosome and associated proteins [BR:otw03036]
    112234003
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112234003
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112234003
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112234003
 Endocytosis
  Macropinocytosis
   Kinases
    112234003
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112234003
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 112234003
NCBI-ProteinID: XP_024257741
LinkDB
Position
Unknown
AA seq 549 aa
MSDNGDVEDKPPAPPMRNTSTLIGSCSKDPAPHGSKPLPPNPEDRKKKDRSIMSILTGGG
DKTNKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQA
VLDVLKFYDSKETNNSQKYMSFTDKSSDNYSCSNTSSSKAVSETPAIATVSEDEDEDEAT
PPPVVAPRPEHTKSIYTRSVIDPLPAPPTRDVATSPISPPLPEGATSAITPPTSPSPGPS
LPRPADKTRKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEV
AIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVV
TETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITP
EQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLI
ATNGTPELQNPEKLSSVFRDFLNCCLEMDVEKRGSANDLLQHQFLKVAKPLSSLTPLIQA
AKEAAKANR
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtctgacaatggggacgtcgaggacaagcccccagccccacccatgaggaacaccagc
actctgattggctcctgtagcaaagatcctgccccccatggctccaagccccttcccccc
aacccagaggacaggaagaagaaagatcgctccatcatgtccatcctgacaggaggagga
gacaagaccaacaagaagaaggagcgtccggagatctctctgccttctgattttgaacac
accatccacgtgggcttcgatgcagtcactggagagttcacaggcatgccggagcaatgg
gctcggttgctccaaacctctaacatcactaagctggaacagaagaagaatcctcaggct
gtccttgacgttctcaaattctacgactccaaggagaccaacaacagccagaaatacatg
agctttacagacaagagttcagacaactatagctgttccaacacttctagctccaaggct
gtgtcagagacgcccgccatagcaaccgtatctgaagacgaggatgaagatgaggccaca
ccccctcctgttgtcgctccccgaccagaacacactaaatcaatatacactcgttctgtg
atagatcccctcccagcccctcccaccagagacgttgccacgtcgcctatctccccccca
cttccggagggtgccacctccgcaatcacgccccccactagcccctcccctggtccatca
ctgccacggcccgcagacaaaacacgcaagaagatgtctgatgaagagatactggagaaa
ctgcggagtatagtcagtgtgggagaccccaagaagaaatacacgcgcttcgagaagatt
ggacaaggtgcgtcaggtacggtatatacagccatagacatcgctacaggccaggaggtg
gccattaaacagatgaacctgcagcagcagcccaagaaggagctcatcatcaatgagatc
ctggtcatgagggaaaacaagaaccccaacatagtcaactacctggacagttacctggtg
ggggaggagctgtgggtggtgatggagtatctggctggaggttctctgactgacgttgtc
acggaaacctgtatggacgaggctcagatcgctgctgtgtgtcgggagtgtctgcaggcc
ttggaattcctccattccaaccaggtgattcatcgtgacatcaagagtgacaacatcctt
ctgggaatggacggatcagtgaaactcactgactttgggttctgtgcccagatcactcca
gagcagagtaagaggagcaccatggtggggactccctattggatggctccagaggtggtg
accagaaaggcctacggtcctaaagttgacatctggtctctaggcatcatggctatagag
atggtggagggagaacccccttacctcaacgagaacccactcagggcgttgtatctgatt
gcgaccaacgggactccagaacttcagaacccagagaaactgtcctcagtcttcagagac
ttcctcaactgctgcctggagatggatgtggagaagagagggagcgctaatgacctacta
cagcaccagttcctgaaggtggccaagcctttatccagtctgactcctctcatccaggca
gccaaagaagcagctaaggctaaccgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236105
Entry
112236105         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112236105
   04012 ErbB signaling pathway
    112236105
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112236105
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112236105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112236105
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112236105
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112236105
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 112236105
NCBI-ProteinID: XP_024260454
LinkDB
Position
Unknown
AA seq 421 aa
MPEQWSKLLQTSNISKSEQKQNPQAVLDILKFYDSSTAKQKYLSFSEKDAQSPGKQGATS
SPSGGKDGDDDEDDGDDEAPPPIVAPRPEHTKSVYTKSVIDPLPPLPEPDSASNRNKKKQ
QGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGAEVAIKQINLQ
KQPKKELIINEILVMKELQQPNIVNYVDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEA
QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTM
VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPEL
QSPEKLSPVFRSFLSRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKSN
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgccggagcagtggtccaaactgctccagacgtctaacatcagtaaatcggaacagaag
cagaatcctcaggctgttctggacattctcaagttctacgactcctccactgcaaaacag
aaatacctctccttctcagaaaaagatgcacagtcgcctggaaagcagggtgccacgtcc
tcgccatcaggcggtaaggacggtgatgatgatgaggatgatggggatgacgaagcgccg
ccccctattgtggcgccacggcctgagcacaccaaatcagtgtacaccaagtctgtcatc
gacccacttcctccgctgccagagcctgactccgcctccaacaggaacaagaagaaacag
cagggcaagatgactgacgaggaaatcatggagaaactacgaaccatcgtcagtattgga
gatcccaagaagaagtacacacgctatgagaagatcggccagggagcgtctggtactgtc
tatacagccatcgatgttgccactggtgcagaggtagctatcaaacagatcaacctccag
aaacagccgaagaaggagctgatcatcaacgagatcctggtgatgaaggagttacagcaa
cctaacatcgtcaactacgtagacagtttcctggtaggtgaggagttgtttgtggtgatg
gagtatctggctggaggttcgctcacggacgttgtcacggaaacatgcatggacgaggct
cagatcgctgctgtgtgcagagagtgtctgcaggctctggagtttctccatgccaaccag
gtgatccacagagacatcaagagtgacaacgtgctgctgggcatggacggatctgtcaaa
ctcactgactttgggttctgtgcccagatcactccagagcagagtaaaagaagcaccatg
gtggggactccctactggatggctcctgaggtggtgaccaggaaggcctacggacccaag
gtggacatctggtccctgggcatcatggctatagagatggtggagggagaacccccttac
ctcaacgagaacccactcagggccctctacctgatagccaccaatgggactccagagctc
cagtctccagagaagttatctccagtgttcaggtccttcctgtcccgctgtctggagatg
gatgtagagaagagaggaggggggaaagaactactgcagcatccattcctaaagctggcc
aagcctctctccagcctcacccctctcatcctggcagccaaggaggccatgaagagtaac
cgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245139
Entry
112245139         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112245139
   04012 ErbB signaling pathway
    112245139
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245139
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112245139
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112245139
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112245139
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6 Haspin_kinase
Other DBs
NCBI-GeneID: 112245139
NCBI-ProteinID: XP_024268932
LinkDB
Position
1
AA seq 531 aa
MCDNGDPEDKPPAPPVRMSSTIFSTGSSKDPLSANHSSKPLPSVPEERKPRNKIISIFSG
AEKGGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSENDGFPAGPHSPVKKGTEPSSISIKDIDDDDD
DDDEAPPPIVAPRPEYTKSVYTRSVIDPIPAPATCPDGDAASKALDRQKKKGKMSDEEIM
DKLRTIVSIGDPRKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIIN
EIMVMKELKNPNIVNYVDSFLVGEELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECL
QALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPE
VVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIF
RDFLNLCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKGNR
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtgtgataacggggatcccgaggacaagcccccagcccccccagtcaggatgagcagc
accatcttcagcaccggctccagcaaggacccgctctcagccaatcacagctccaagccc
ctgccctcagttccggaagaaagaaaaccccgcaacaagataatctcaattttctcagga
gcagagaaaggtggtagaaagaaagaccgggacaaagaacgaccagagatctctcctcct
tcagactttgaacacactatccacgttggctttgatgctgtcactggggagttcactggc
atgccagagcaatgggcacggctcctccagacgtcaaacatcacaaagtcagagcagaaa
aagaacccccaggctgttctcgacgtgctcaaattctatgattctacaggcaacggccgc
cagaaatacctcagtttctcctctgaaaatgatggtttccctgcaggaccccactctccg
gtcaaaaagggcacggaaccctcatcgatcagtatcaaggacattgatgatgatgatgat
gatgatgatgaagctcccccacccattgtggcaccacgtccagaatacactaagagtgtt
tacactcgctccgtcattgaccccatccctgctccagccacgtgtccagatggagacgca
gcctccaaggctctagacagacagaagaagaagggcaagatgtcagacgaggagatcatg
gacaaactaagaactattgtcagcattggagatcccagaaagaagtacacaagatatgaa
aaaattggacagggggcttcagggacagtgttcacagccattgacgtcgccactggacag
gaggtggccattaaacagatcaacctacagaagcagcccaagaaggagctgataatcaat
gagattatggtgatgaaagagttaaagaatccgaacattgtcaactatgtagacagtttc
ctggtgggagaggagctctatgtggtgatggagtatttggctggtggttcgctgactgat
gtggtgacagagacctgcatggacgaggctcagatagctgctgtctgcagagagtgttta
caagcactggagttccttcatgcgaaccaggtcatccatcgtgacatcaagagtgacaac
gtgctactgggaatggatggctctgtcaagctcaccgattttggtttctgcgcccagatc
actccagagcagagcaagcgcagcaccatggtgggtacgccttactggatggctcctgag
gtggtgacccggaaagcctatgggcctaaggttgatatctggtcactgggcatcatggcc
attgagatggttgagggggagcctccatacctcaatgagaacccgctaagagcactgtac
ctgattgccacaaatgggactccagaacttcagaacccagagaaactgtctcccatattc
agagacttccttaacctctgcctggaaatggatgtggagaagagaggtgggggcaaagag
ctgctgcagcatcccttcctgaagctggcaaaacccctgtctagtcttacacctctaatc
ttggctgctaaggaggccatgaaaggcaaccgttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249908
Entry
112249908         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112249908
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249908
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112249908
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112249908
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112249908
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112249908
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 112249908
NCBI-ProteinID: XP_024275396
LinkDB
Position
5
AA seq 672 aa
MFRRKKKRRPEISAPQDFEHRVHTSFDAVQGCFVGLPPQWQSVIDILRRPKPVVDPSRIT
NVELRPKKTICRGSFIGHGDYISHVISEMTRLTVTSSNSLRKSSPSARQRARSMGRLGEL
VEGDTYQYEELGQEKRHNGSSSYWQVQSESGSPKLALRKTSTLQPNGVLPRAKSTHEMST
AAGDKPAPLPKGPVPTPPRGGGTGHYTRSEWSGLINRPGQQMGMPQKGKVANQRPASCYN
LQTLQTQQQVNMRVKPGVNHLPDLLTSSKDTSPQRPHSSCDLKMNSLGPSAMSLPNGTSS
LIAGRGRTHRPSRSSSSYTIGLLSPIVQGATMPLLPKQDSPSQPRPSPTGSPATSSTGTA
QQQQPKLGPEPEPAKVTHGQFKAALQMVVDKGDPRTSLENFVKIGEGSTGVVCIARERHS
GRQVAVKMMDLRKQQRRELLFNEVVIMRDYRHNNVVEMYRSALVEEELWVIMEYLQGGAL
TNVVSETRLNEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLTLDGRIKLSDFGFCA
QISKDIPKRKSLVGTPYWMAPEVVSKTPYGTQVDVWSLGIMVVEMVDGEPPYFSDTPVAA
MKKLRDEPPPTVRNTQKISPVLKDFLDRMLTRDPQERATASDLLEHPFLLQCGSRQCLVP
LVERYRKRMSRC
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgttccggcggaaaaagaagcggaggccggagatctcggcgccacaggactttgagcac
cgggtccacacgtcattcgacgcagtgcaggggtgcttcgtgggcctgccgccccagtgg
cagagcgtcattgacatcctgaggaggccaaaaccagtggtggacccgtcccggatcacc
aatgtggagctcaggcccaagaagaccatttgtagggggagtttcataggacacggagac
tacatctcccatgtcatctcagagatgactcgtcttaccgtcaccagttccaactcgctc
cggaaaagcagtccttcggcgcggcaacgggcacgctccatggggcgtctgggcgagctc
gtcgaaggggacacttatcagtatgaggagctgggccaagagaagcgtcataacggcagt
agcagctactggcaggtacaaagcgagagcggcagccccaaactggctcttaggaaaaca
tccaccctccagcccaatggggtactgcctcgggcaaagtcgacgcatgagatgagcacg
gcagctggggataaacctgcacctctgccgaaggggccagtccccacgccccctagagga
ggcggcacaggtcattatacacgtagcgaatggtccggacttataaatcggccgggacaa
cagatggggatgccgcaaaagggcaaggtagccaatcagaggccggcatcctgctataac
ctgcagaccctgcagacgcagcagcaggtcaacatgagggtcaagcctggggtcaatcac
ctgccggaccttctgacctcctccaaggatacttctcctcagagaccccactcatcctgt
gacctgaagatgaattcattagggccctcggccatgtccttacccaatggcaccagcagc
ctgatcgcaggccgagggcgaacccacagaccctcacgctcctcctccagctacaccatt
ggattgttatcacccatagttcagggggctaccatgcccctactccccaaacaggacagc
ccatcccagccccggccttctcccacgggctccccggccaccagctcaacaggaacggcc
cagcagcaacagcccaagctcgggccagagcctgagccggccaaagtgacccatgggcag
ttcaaagcggccctgcagatggtagtggacaagggcgacccgcgcacctccctggagaac
tttgtgaagatcggggagggctccacgggggttgtgtgcattgcccgcgagaggcatagc
ggtcggcaggtggcggtgaagatgatggatctccgtaagcagcagcgcagagagctgctc
tttaacgaggtggtgatcatgagggactaccggcacaacaacgttgtggagatgtacagg
agtgccctggtggaagaggagctgtgggttatcatggagtacctgcagggtggcgctcta
accaacgtcgtgtctgaaaccaggctgaatgaagagcagatagccaccgtgtgcgaggct
gtgctacaggcgttagcctatctccattcccagggagttatccaccgtgacatcaagagt
gactctatactgctcacgctggatgggaggatcaagctgtcagactttggattctgtgct
cagatcagcaaagacatccccaaaaggaagtccttggttggaacaccgtactggatggct
ccagaggttgtgtcaaagacaccatatggaactcaggtggatgtgtggtccctgggtatc
atggtggtagagatggtggatggagagcctccgtacttcagcgacacaccagtggcagct
atgaagaaactgagggacgagccgccacccacagtcaggaatacacagaagatctcccct
gtgttgaaggacttcctggatcgtatgctaacacgggacccccaggagcgggctaccgct
agcgacctgctggagcaccccttcctgctgcagtgtggctcgcggcagtgcctggtgccc
ctagtggaacgataccgtaagcgcatgtcccgctgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250569
Entry
112250569         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 5-like isoform X1
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112250569
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250569
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250569
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112250569
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112250569
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 112250569
NCBI-ProteinID: XP_024276595
LinkDB
Position
5
AA seq 776 aa
MFGKKKKRLEISAPSNFEHRVHTGFDEREQKFTGLPQQWQSLLADTANRPKPMVDPSYIT
PIQLAPMKISPKKIRSAETPLRKTIVRGNRPPKDTSINGLLEEFDSISVTRSNSLRKESP
TGPHQAGSGAPKPPSHHPTHQPHAPEENGFSHYYSRYSCDLDTSSRDFSLEPYRKDGKGF
ALDGDWAVGRHYRFPKQNGHLTHATRVPFYPDAMPQKTDYAKLPPDYHTYLESKVAGARL
ADEVGSGSGVGSAGGSAGSTTGGYYRASVGGSSSQDYRDASMVGTPSRASLHSEQINYPD
SEWSYSGMSRDEYEKRPKSSYVMQTSPTPAIRQRSRSGSGLQEPNVPYGASGAFKSPPQT
HPYSSYTYPRLSETLTNSQAMAKGDYDQSSWDGSPQVPGSDTYPRGPLKLPQSHSKPSGY
PPGLQYPPVFHHYKPSPYHHPPSQPSPPYTPQGAYSQPSSPYIPPGAYPPPSWGSSSDAQ
PSRVSHEQFRAALQLVVNPGDPREYLESFIKIGEGSTGIVCIASEKHSGKQVAVKKMDLR
KQQRRELLFNEVVIMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEE
QIATVCVSVLRALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSL
VGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRL
KESHKVSSVMRAFLDLMLVREPSQRATAQELLQHPFLKLSGPPSCIVPLMRHYRHR
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtttgggaaaaagaagaagaggctagagatttcggctccgtctaacttcgagcaccgg
gtccacactggtttcgacgagcgggagcagaagttcacaggtctgccccagcaatggcag
agtctcctggcagacacagccaacagacccaagcccatggtggacccctcctatatcaca
cccatacagctggctcctatgaagatatctcccaagaaaatccggtcggccgaaacaccc
ttgcgaaaaaccatcgttcgagggaaccggcccccgaaggacacgtccatcaatggtctc
ctggaggagttcgacagcatctctgtgacacgttccaactccctgcgtaaagagagccct
acgggcccccaccaggccgggtccggggcccccaaacccccctcccaccaccccacacac
cagccccacgcccctgaggagaacggcttcagccactactactcccgctactcctgtgac
ctggacacctccagtagggacttctctctggagccctacaggaaggacggtaaaggcttc
gctctagatggggactgggccgtggggagacactaccgcttccccaaacagaacggccac
ctcacccacgccacccgcgtccccttctaccccgacgccatgcctcagaagaccgattac
gccaagctgcctccggactaccacacgtacttggagagcaaggtggcgggggcgcgcttg
gccgacgaggtgggatctgggtccggggtgggaagcgcaggggggtctgccgggtccacg
acaggggggtactaccgggcgtccgtaggcggttcgtccagtcaggactaccgggatgcg
tcgatggtggggacaccgtcgcgagcctcgctgcacagcgagcaaatcaactacccagat
agcgagtggagctacagcggcatgtccagagacgagtacgagaagaggcctaagtcgtcg
tacgtgatgcagaccagccccacgccggccatccgacagcgctccaggtcggggtccggc
ctccaggagcccaacgtgccctatggggccagcggggcttttaagagtccccctcagaca
cacccctacagctcctacacctacccacgcctctcagagactctcaccaactcacaggcc
atggccaagggtgattacgaccagtcgtcttgggacgggagtccccaggtcccagggtct
gacacatacccgcgcgggcccctcaaactacctcaaagccacagcaagccctctggctac
ccccccggactccagtacccccctgtgttccaccactacaaaccctccccctaccaccac
ccaccctcacagcccagcccgccatacactccacagggggcatactcccagccatcgtcc
ccttacatccccccgggggcctacccccctccctcctggggctccagttcagatgcccag
ccctccagggtctcccacgaacagttcagggctgccttgcagctcgtcgtcaacccaggt
gaccccagggagtacctggagagtttcataaagattggcgagggctcgacgggcatcgtg
tgcatcgccagcgagaagcatagtggcaagcaggtggccgtcaagaagatggacttgagg
aaacagcagaggagagaactgctcttcaatgaggtggtgatcatgagggactatcaccat
gagaacgtggttgacatgtacaacagctacctggttggagacgagctctgggtcgttatg
gagttcctggagggcggggccctgacggacattgtcactcacacgaggatgaacgaggag
cagatagccaccgtgtgtgtgtcggtgttgagggctctgtcgtacctccacacgcaggga
gtcatccacagagacatcaagagtgattctatcctcctcaccagcgatggacgcatcaag
ctgtcagactttggcttctgcgcccaagtgtccaaagaggtgcccaagaggaagtctctg
gtgggcacgccctactggatggcaccggaggtcatctcgcggttaccctacggcacagag
gtggatatctggtcgttgggcatcatggtgatagagatgatagatggggaacccccgtac
tttaacgaaccccctctacaggccatgaggaggatacgagacaacctgcccccacggcta
aaggagtcacacaaggtatcatcggttatgagggccttcctcgacctgatgttagttaga
gagccgtctcagcgagccacagcccaggagctgctccagcaccccttcctcaagctctcg
ggccccccatcttgcatcgtccccctaatgaggcactaccgccaccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250960
Entry
112250960         CDS       T05605                                 

Gene name
pak2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112250960 (pak2)
   04012 ErbB signaling pathway
    112250960 (pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250960 (pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250960 (pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112250960 (pak2)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112250960 (pak2)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112250960 (pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo zinc-ribbons_6 Haspin_kinase
Other DBs
NCBI-GeneID: 112250960
NCBI-ProteinID: XP_024277302
LinkDB
Position
5
AA seq 530 aa
MCDNGDPEDKPPAPPVRMSSTIFSTGSSKDPLSANHSSKPLPSVPEERKPRNKIISIFSG
AEKGGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSSEKDGFPTGPQSPVKNVMEPSSTNIKDIDDDD
DDEAPPPIVAPRPEYTKSVYTRSVIDPIPAPATCPDGDSASKAVDRQKKKGKMSDEEIMD
KLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINE
IMVMKELKNPNIVNFVDSFLVGEELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQ
ALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV
VTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFR
DFLNHCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKGNH
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtgtgataacggtgatcccgaggacaagccccctgcccccccggtccggatgagcagc
accatcttcagcacaggctccagcaaggacccactctcagccaatcacagctctaagccc
ctgccctcggttccagaggagaggaaaccccgcaacaagatcatctccattttctcaggc
gcagagaaaggtggtagaaagaaagaccgggacaaagaaagaccagagatctctccgcct
tcagactttgaacacaccatccacgttggctttgatgctgtcactggggagttcactggc
atgccagagcaatgggcacgacttctccagacatcaaacatcaccaagtccgagcagaag
aagaacccacaggctgttctcgacgtgctcaaattctatgactctacgggcaacggccgc
cagaaatacctcagtttctcctcctctgaaaaggatggtttccccacaggaccccagtct
ccggtcaaaaatgtcatggaaccctcatcgaccaatatcaaggacattgatgatgatgat
gatgatgaagctcccccacccattgtggcaccacgtccagaatacactaagagtgtgtac
actcgctccgtcattgaccccatccccgctccagccacatgcccagatggagactcggcc
tccaaggctgtagacagacagaagaagaagggaaagatgtcagacgaggagatcatggac
aaactgagaactatagtcagcattggagatcccaaaaagaagtacacgagatatgaaaaa
attggacagggggcttcagggacagtgtacacagccattgatgtcgccacaggacaagag
gtggccattaaacagatcaacctacagaagcagcccaagaaggagctgatcataaatgaa
attatggtgatgaaagagttaaagaacccgaatattgtcaacttcgtagacagtttcctg
gtgggagaggagctctatgtggtgatggagtacttggctggtggctcgctgactgatgtg
gtgacagagacctgcatggatgaggctcagatagctgctgtctgcagagagtgtttacaa
gcactggagttccttcatgcgaaccaggtcatccatcgtgacatcaagagtgacaacgtg
ctactggggatggatggctctgtcaagctcaccgattttggtttctgcgcccagatcaca
ccagagcagagcaagcgcagcaccatggtgggcacgccttactggatggcacctgaagtg
gtgacccggaaggcctacgggccaaaggttgatatctggtccctgggcatcatggccatt
gagatggttgagggggagcctccatacctcaatgagaacccgctaagagcactgtacctg
attgctaccaatggcactccagagctgcagaacccagaaaagctgtcccccatcttcaga
gacttccttaatcactgcctagaaatggatgtggagaagagaggcgggggaaaagagctg
ctgcagcatcccttcctgaagctggcaaagcccctctccagtcttacacctctcatcttg
gctgctaaggaggccatgaaaggcaaccattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255751
Entry
112255751         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112255751
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255751
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112255751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112255751
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112255751
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112255751
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 112255751
NCBI-ProteinID: XP_024284369
LinkDB
Position
8
AA seq 762 aa
MFRKKKKKRPEISAPKNFEHRVHTSFDAKRGCFVGLPTQWHSLIENLRRPKPMVDPSRIT
PVELNPKKTIVRGSMIGHGDYISAMISDMSRLSVTSSNSLRKSSPSGRKRAQSLGRLGEV
KEGDTYQYEDLGEDDMEQQQWRDRAHNIHSESGMPQMGMKKSITLQPNGDLPRAKSTYEV
SVSSLEGPPVPSQPIQVPIKGAYISCEVGSPTERLMVRRDFQVPRVMPHNQRPFSCFYNP
AMAVQHPHPDHGRHPPPEYRTNLYIHSHNSPSRPYSSYDLKAESALRHHQSGFLPSTPSS
PFMSGIRPHRTVRSSASYTLGLSPNMGLRLNGPDPFLRHSGCPNAPFPRQDSPSXAESAL
RHHQSGFLPSTTSSPFMSGIRPHRTVHSSASYTLGLSPNMGLRPNGPDPFLRHSGCPNAP
FPGQDSPSQLRPSPTGSLATSPLGTCSPAFRPPQHPQRPPPDPPKVTHKQFKAALQMVVD
KGDPRSYLENFVKIGEGSTGVVCIAREKHSGRQVAVKMMDLRRQQRRELLFNEVVIMRDY
QHRNVVEMFKSALVEEELWVIMEYIEGGALTNIVSETRLSEEQIATVCEAVLQALAYLHS
QGVIHRDIKSDSILLTLDGRIKLSDFGFCAQISKDIPKRKSLVGTPYWMAPEVISKSPYS
TEVDVWSLGIMVVEMVDGEPPYFSETPVAAMRRLRDEPAPTVRNTTQVSPVLKDFLNRML
TRDPVERASATDLLEHPFLLQSGSPQCLVPLVEQYRKRMSHC
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgtttcgtaagaagaaaaagaagaggccagagatctcggcaccaaagaactttgagcac
cgggtgcacacctcttttgatgctaaacgaggctgcttcgtgggcctgccaacccaatgg
cacagtttgatagagaacctccgcaggcccaagcctatggtggacccctcccggatcacc
ccagttgagctcaatccaaagaagaccattgtgcgtgggagtatgatcggccatggagac
tacatctcagccatgatctccgacatgagcaggctgtccgtgaccagctccaactcccta
aggaagagcagcccttcaggcaggaagagggcccagtcccttggcaggctgggggaggtg
aaggagggggatacctaccagtatgaagacctgggagaggatgacatggagcagcagcag
tggagggacagggctcataacatccacagtgagagtgggatgccccaaatgggcatgaag
aagagcatcaccctgcagcccaacggggatcttcccagggctaagtccacctacgaggtg
agtgtcagctctctagagggacccccggttccatcccagcccatacaggtgcctattaaa
ggggcttatatcagctgtgaggtgggcagtcccacagagagactgatggtgaggagagac
ttccaggtgccgagggttatgccacacaaccagaggcccttctcatgcttctacaaccca
gccatggctgtccagcacccccatcctgaccatgggcgtcacccccctccggagtaccgc
accaacctctacatccactcccacaacagccctagcagaccatactcctcctacgacctg
aaggcagagtcggctctgaggcaccaccagtcaggcttcctacccagcacccccagcagt
cccttcatgagtggcatcagaccccacaggacagtgcgctcttcagccagctacaccctg
ggactgtctcccaacatgggcctgagactcaatgggcctgacccttttttgagacactca
gggtgccctaatgctcccttccccaggcaggacagcccctcccangcagagtcggctctg
aggcaccaccagtcaggcttcctaccaagcaccaccagtagtcccttcatgagtggcatc
agaccccacaggacggtacactcctcagccagctacaccctgggactgtctcccaacatg
ggcctgagacccaatggccctgacccctttctgagacactcaggctgccctaatgctccc
ttccccggacaggacagcccctcccagctccggccttcccccaccggctccctggccacc
agccctctaggcacatgttcccctgccttcagaccccctcagcacccacagaggccgcca
ccagacccccccaaggtgacccataaacagtttaaggctgccctgcagatggtggtagac
aagggagaccctcggtcgtacctggagaactttgtgaagattggagaagggtccacaggg
gtggtgtgtatcgctcgggagaaacacagtggcaggcaggtggccgtgaagatgatggac
ctgcggagacaacagcgaagagagctgcttttcaacgaggtggtgatcatgagggactac
cagcacaggaacgtggtggagatgtttaagagtgccctggtggaggaggagctctgggtc
atcatggagtacatagagggtggagcactaaccaacatcgtgtctgagaccaggctgagt
gaggagcagatagccacagtgtgtgaggctgtgctgcaagccctggcctaccttcactcc
cagggagtcatccacagggacatcaagagtgactccatactgctaacactggatgggagg
atcaagctgtcagactttgggttctgtgcacagatcagtaaggacattcccaagaggaag
tctttagtaggaacaccctactggatggctccggaggtcatctctaaatctccatacagc
actgaggtggatgtgtggtctctgggcatcatggtagttgagatggtggacggagagccc
ccctacttcagtgagacccccgttgcagccatgagaagactgagggatgagccagctccc
accgtacggaacacaacccaggtatccccggtgttgaaagacttcctgaaccgtatgttg
acccgggacccagtggagagggccagcgccacagacctgctagaacaccccttcctcctg
cagagcggctccccgcagtgcctggtgcccctggtggagcagtaccgcaagcgcatgtct
cactgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262320
Entry
112262320         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112262320
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112262320
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112262320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112262320
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112262320
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112262320
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 112262320
NCBI-ProteinID: XP_024293765
LinkDB
Position
11
AA seq 679 aa
MFRKKKKKRPEISTPKNFEHRVHTSFDAKRCCFVGLPTQWHSLIENLRRPKPMVDPSRIT
SVELKPKKTIVRGSMIGHGDYISTMISDMSRLSVTSSNSLRKSSPSARKRAQSLGRLGEV
KEGDTYQYEDLGEDALEQQQWRDRAHNIHSESGMSITIQPNGILPRAKSTYEVSISCLEG
PLAPSQPMQVPIKGAYISCEVGSPTETLMVKRDFQVPRVMPQKQRPISFFYSPAMAVQHT
DHGGRPPPEYSTNLYIHSHNSPGRPYSSYDLKAESALRHHQSGFLPSTTSSPFMSGIRPH
RTVHSSASYTLGLSPNMGLRPNGPDPFLRHSGCPNAPFPGQDSPSQLRPSPTGSLATSPL
GTCSPAFRPPQHPQRPPPDPPKVTHKQFKAALNMVVDKGDPRSYLENFVKIGEGSTGVVC
IAREKHSGRQVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNVVEMFKSALVEEELWVIME
YLQGGALTNIVSETRLSEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLTLDGRIKL
SDFGFCAQISKDIPKRKSLVGTPYWMAPEVISKSPYSTEVDVWSLGIMVVEMVDGEPPYF
SETPIAAMRRLRDEPAPTVRNATQVSPVLKNFLDRMLIRDPVERASSTDLLEHPFLLQSG
SPQCLVPLVEQYRKRMSRC
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgtttcgtaagaagaaaaagaagaggccagagatctcaacaccaaagaactttgagcac
cgggtgcacacctcgtttgacgccaagcggtgctgctttgtgggcctgccgacccaatgg
cacagtctgatagagaacctccgtaggcccaagcctatggtggacccctcccggatcacc
tccgtggagctcaagccaaagaagaccatcgtgcgtgggagtatgatcggtcatggagac
tacatctcaaccatgatctccgacatgagcaggttgtcggtgaccagctccaactccctg
aggaagagcagcccttcggccaggaaaagggcccagtccctgggcaggctgggggaggtg
aaggagggggacacctaccagtatgaagacctgggagaggatgcgctggagcagcagcag
tggagagacagggctcataacatccacagtgagagtgggatgagtattaccatacagccg
aacggcattctccccagggccaagtccacctatgaagtgagcatcagctgtctggaggga
cccctggctccatcccagccaatgcaagtgcctattaaaggggcttatatcagctgtgag
gtgggtagccccacagagacactgatggttaagagagacttccaggtgcccagggttatg
ccacaaaaacagaggcctatctcgttcttctacagcccagccatggctgtccagcatacc
gaccatgggggtcgcccccctccggagtacagcaccaacctctacatccactcccacaac
agccctggcagaccatactcctcctacgacctgaaggcagagtcggctctgaggcaccac
cagtcaggcttcctaccaagcaccaccagtagtcccttcatgagtggcatcagaccccac
aggacggtacactcctcagccagctacaccctgggactgtctcccaacatgggcctgaga
cccaatggccctgacccctttctgagacactcaggctgccctaatgctcccttccccgga
caggacagcccctcccagctccggccttcccccaccggctccctggccaccagccctcta
ggcacatgttcccctgccttcagaccccctcagcacccacagaggccgccaccagacccc
cccaaggtgacccataaacagtttaaggctgccctgaacatggtggtggacaagggagac
cctcggtcgtacctggagaactttgtgaagattggagaagggtccacaggggtggtgtgt
atcgctcgggagaaacacagtggcaggcaggtggccgtgaagatgatggacctgcggaga
caacaacgtagagagctgcttttcaacgaggtggtgatcatgagggactaccagcacagg
aatgtggtggagatgtttaaaagtgccctggtggaggaggagctctgggtcattatggag
taccttcagggtggagcactaaccaacatcgtgtctgagaccaggctgagtgaggagcag
atagccacagtctgtgaggctgtgttgcaagccctggcctaccttcactcccagggggtt
atccacagggacatcaagagtgactccatactgctaacactggatgggaggatcaagctg
tccgactttgggttctgtgctcagatcagtaaagacatccccaaaaggaagtctttagtg
ggaacaccctactggatggctccggaggtcatctctaaatcaccatacagcactgaggta
gatgtgtggtctctgggtatcatggtagttgagatggtggatggagagcccccttacttc
agtgagacccctattgcagccatgagaagactgagggatgagccagctcccactgtacgg
aacgcaacacaggtctccccggtgttgaagaacttcctggaccgtatgttgatccgagac
ccagtggagcgtgccagctccacagacctgctagaacaccccttcctcctacagagcggc
tccccgcagtgcctggtgcccctggtggaacagtaccgcaagcgcatgtcccgctgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265297
Entry
112265297         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 4-like
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112265297
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265297
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265297
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112265297
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112265297
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 112265297
NCBI-ProteinID: XP_024298220
LinkDB
Position
13
AA seq 658 aa
MFTKKKKPRVQISAPSNFEHRVHTDFDEQEQKFVGLPRQWQSLIEDTAKRPKPFIDVTVI
TTVEPRKTIVRGSKIAVDGSLTWLLDEFDTMSVTRSNSLRRGSPPIQPRRDSGSSGGGGH
ENGDLAHRTHHHPDHYGDRDRERPRPDQLAGGDPRHPQRVPRSQREDGRPQQQPRGQEPG
SRHRERERPCPPPPPPKPRDMDPRDHHDQVVRRDGPSDKRPKSSYTGRDGSPQSPRDKRP
LSGPNIRMPNLPVTEGVIKTAQQSSRPFNTYPRADSEGGRSPTSQELKPARTHETPRHNG
PSSGRSGGKAPQQGQLRGEPHHSSHPVLGPEPPHGYQQLKAPVPRPPAPALPPQQALSPQ
REPQRVSHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATVKSTGKLVAVKKMD
LRKQQRRELLFNEVVIMRDYHHDNVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMN
EEQIATVCLSVLKALSVLHTQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVQRRK
SLVGTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPP
KLKNLHKVSPLLKGFLDKLLVRDPTQRASANELLKHPFLSKAGPPSCIVPLMRQNRMR
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgttcaccaagaagaagaagccccgcgtccagatttcggcaccttccaacttcgagcac
cgcgtgcacacagactttgacgagcaagaacagaagtttgtggggctgccgcggcaatgg
cagtctctgatcgaggacacagccaagaggcccaagcccttcatcgacgtcaccgtcatc
accactgtggagccccgcaagaccatagtgcggggtagtaagatcgctgtggacggctcg
ctgacatggctgctggatgagtttgacaccatgtcggtgacccgctccaactccctgagg
cgaggcagccccccgatccagccccgcagagactccggatcctcagggggaggaggccat
gagaacggggacctggcccatcggacacaccaccacccagatcactatggagacagagat
agggagcggcccaggccagaccagttagctggtggagacccccggcatccccagcgggta
ccccgctctcagagagaggacggccggccacagcagcagccccggggccaggagccaggc
agcaggcaccgagagagggagcggccctgcccaccccctcccccgccaaagcccagagac
atggacccacgggaccaccacgaccaggtagtccgcagggacgggcccagcgacaagagg
cccaagtccagctacacaggcagggacggcagcccccaatcgccccgggataagaggcct
ctctcggggcccaacatccgtatgcctaacctccctgtcacagagggggtgataaagaca
gcacagcagagcagtaggccgttcaacacctacccccgcgctgacagtgaaggaggaaga
agccccaccagccaggagctgaagccagcccgaacacacgaaacaccgcgccacaatggt
ccctctagtggccgcagcgggggcaaagccccacagcagggccagctacgaggagaaccc
caccactcctcccaccctgtcctgggccctgagcccccccacggctaccagcagctgaag
gctcctgttccccgccctccggcccctgccctaccaccacagcaggccctctcaccccag
agggagccccagcgggtgtcccatgagcagttccgcgccgcactacagatggtggtggac
ccgggtgacccgcgcacctacctggaccactacatcaagattggagagggctccaccggc
attgtgtgcattgccaccgtcaagagcaccggcaaactggtcgctgtcaagaagatggac
ctgcgcaagcagcagcgccgggagctgctattcaatgaggtggtgataatgcgggactat
caccatgacaacgtggtggagatgtacaacagctacctggtgggagatgaactctgggtc
gtcatggaattcctggagggaggggctttgactgacatcgtcacacacaccaggatgaat
gaggagcagatagccacagtgtgcctgtctgtgctgaaggctctgtcagtgctgcacacc
cagggcgtcatccacagggacatcaagagtgactccatccttctcacccacgatggcaga
gtgaagctgtcagactttggcttctgcgcccaggtgtctaaagaggtccagcggcgcaag
tccctggtaggcacaccctactggatggccccagagctcatctcacgactaccctatggg
cctgaggtggacatctggtccttgggggtgatggtgattgagatggtggacggagaaccc
ccctatttcaatgagccccccctcaaagctatgaagatgatccgtgacaacctaccaccc
aaactcaagaacttacacaaggtttctcctctcctcaagggcttcctggacaaattgctg
gtgcgagaccctacccagagggcctcagccaatgagctgctcaagcaccccttcctgagc
aaggctggcccgccctcctgcatcgtgcctctcatgaggcagaaccgcatgagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265443
Entry
112265443         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 1-like
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265443
   04012 ErbB signaling pathway
    112265443
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265443
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265443
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112265443
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112265443
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265443
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112265443
   03036 Chromosome and associated proteins [BR:otw03036]
    112265443
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112265443
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112265443
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112265443
 Endocytosis
  Macropinocytosis
   Kinases
    112265443
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112265443
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo DUF3402
Other DBs
NCBI-GeneID: 112265443
NCBI-ProteinID: XP_024298506
LinkDB
Position
13
AA seq 553 aa
MSDNGDVEDKPPAPPMRNTSTLIGSCSKDPAPHGSKPLPPNPEDRKKKDRSIMSILTGGG
DKTNKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQA
VLDVLKFYDSKETNNSQKYMSFTDKSSDNYSCSNTSSSKAVSETPAIATVSEDEDEDEAT
PPPVVAPRPEHTKSIYTRSVIDPLPAPPTRDVATSPISPPPPEGATSAITPPTSPTPSPA
PGPSLPRPADKTRKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIAT
GQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGEELWVVMEYLAGGSL
TDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCA
QITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRA
LYLIATNGTPELQNPEKLSSVFRDFLNCCLEMDVEKRGSANDLLQHQFLKVAKPLSSLTP
LIQAAKEAAKANR
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtctgacaatggggacgtcgaggacaagcccccagccccacccatgaggaacaccagc
actctgattggctcctgtagcaaagatcctgccccccatggctccaagccccttcccccc
aacccagaggacaggaagaagaaagatcgctccatcatgtccatcctgacaggaggagga
gacaagaccaacaagaagaaggagcgtccggagatctctctgccttctgattttgaacac
accatccacgtgggcttcgatgcagtcactggagagttcacaggcatgccggagcaatgg
gctcggttgctccaaacctctaacatcactaagctggaacagaagaagaatcctcaggct
gtccttgacgttctcaaattctacgactccaaggagaccaacaacagccagaaatacatg
agctttacagacaagagttcagacaactatagctgttccaacacttctagctccaaggct
gtgtcagagacgcccgccatagcaaccgtatctgaagacgaggatgaagatgaggccaca
ccccctcctgttgtcgctccccgaccagaacacactaaatcaatatacactcgttctgtg
atagatcccctcccagcccctcccaccagagacgttgccacgtcgcctatctccccccca
cctccggagggcgccacctccgccatcacaccccccactagccccacccctagtcctgct
cctggcccctccctgccacgccccgcagacaaaacacgcaagaagatgtctgatgaagag
atactggagaaactgcggagtatagtcagtgtgggagaccccaagaagaaatacacgcgc
ttcgagaagattggacaaggtgcgtcaggtacggtatatacagccatagacatcgctaca
ggccaggaggtggccattaaacagatgaacctgcagcagcagcccaagaaggagctcatc
atcaatgagatcctggtcatgagggaaaacaagaaccccaacatagtcaactacctggac
agttacctggtgggggaggagctgtgggtggtgatggagtatctggctggaggttctctg
actgacgttgtcacggaaacctgtatggacgaggctcagatcgctgctgtgtgtcgggag
tgtctgcaggccttggaattcctccattccaaccaggtgattcatcgtgacatcaagagt
gacaacatccttctgggaatggacggatcagtgaaactcactgactttgggttctgtgcc
cagatcactccagagcagagtaagaggagcaccatggtggggactccctattggatggct
ccagaggtggtgaccagaaaggcctacggtcctaaagttgacatctggtctctaggcatc
atggctatagagatggtggagggagaacccccttacctcaacgagaacccactcagggcg
ttgtatctgattgcgaccaacgggactccagaacttcagaacccagagaaactgtcctca
gtcttcagagacttcctcaactgctgcctggagatggatgtggagaagagagggagcgct
aatgacctactacagcaccagttcctgaaggtggccaagcctttatccagtctgactcct
ctcatccaggcagccaaagaagcagctaaggctaaccgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266882
Entry
112266882         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 4-like
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112266882
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266882
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112266882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112266882
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112266882
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112266882
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 112266882
NCBI-ProteinID: XP_024300543
LinkDB
Position
14
AA seq 661 aa
MFTKKKKPRVQISAPSNFEHRVHTDFDEQEQKFVGLPRQWQSLIEDTAKRPKPFIDVTVI
TTVEPRKTIVRGSKIAVDGSLTWLLDEFDTMSVTRSNSLRRGSPPIQPRRDSGSSGGGGH
ENGDLAHRPHHHPDHYGDIRDREQPRPDQLAGGDSRQPQRVPRSQREDGRPQQQPRGQEP
SSRHRERERPGPPLPPSKPRDTDPRDHHDQVVRRDGPSDKRPKSSYTGRDGSPQSPRDKR
PLSGPNIRMPNLPVTEGVIKTAQQTSRPFNTYPRADSEGGRSPTSQELKPARPHEAPPHN
GPSSASSRDGGKAPPKGQLRGDPHHSSHPVLGPEPPHGHQQQKAPVPRPPAPALPPQQAL
SPKREPQRVSHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATIKSTGKLVAVK
KMDLRKQQRRELLFNEVVIMRDYHHDNVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHT
RMNEEQIATVCLSVLKALSVLHTQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVQ
RRKSLVGTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDN
LPPKLKNLHKVSPLLKGFLDKLLVRDPTQRASANELLKHPFLSKAGPPSCIVPLMRQNRM
R
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgttcactaagaagaagaagccccgcgtccagatctcggcgccctccaacttcgagcac
cgcgtgcacacagactttgacgagcaggaacagaagtttgtggggctgccgcggcaatgg
cagtctctaatcgaggacacggccaagaggcccaagcccttcatcgacgtcaccgtcatc
accacggtggagccccgcaagaccatagtgcggggtagtaagatcgctgtggacggctcg
ctgacatggctgctggatgagtttgacaccatgtcggtgacccgctccaactccctgagg
cgaggcagcccccctatccagccccgcagagactccggatcttcgggggggggaggccat
gagaacggggacctggcccaccggccacaccaccacccagatcactatggagacatcaga
gacagggagcagcccaggccggaccagttagctggtggagactccaggcagccccagcgg
gtaccccgctctcagcgagaggacggcaggccacagcagcagccccggggccaggaacca
agcagcaggcaccgagagagggagcgtcctggcccaccccttcccccatcaaagcccaga
gacacggacccacgggaccaccacgaccaagtagtccgcagggacgggcccagcgacaag
aggcctaagtccagctacacgggcagggatggcagcccacagtcgccccgggataagagg
cctctctcggggcccaacatccgtatgcctaacctgcctgtcacagagggggtgataaag
acagcacaacagaccagcaggccgttcaacacctacccccgcgctgacagtgaaggagga
aggagccccaccagccaggagctgaagccagccagaccacacgaagcaccgccacacaac
ggtccttctagtgcctccagccgagacgggggaaaagcaccgccgaagggccagctacga
ggagacccccaccactcctcccaccctgtcctgggccctgagcccccccacggccatcag
cagcagaaggctcccgttccccgccccccggcccctgccctaccaccacagcaggccctc
tctcccaagagggagccccagcgggtgtcccatgagcagttccgcgccgcgctgcagatg
gtggtggatccgggtgacccacgcacctacctggaccactacatcaagatcggagagggc
tccaccggcattgtgtgcattgccaccatcaagagcactggcaaattggtggctgtcaag
aagatggacctgcgcaagcagcagcgccgggagctgctattcaatgaggtggtgatcatg
cgggactatcaccatgacaatgtggtggagatgtacaacagctacctggtgggagatgaa
ctctgggtagtcatggagttcctggagggaggggctctgactgacattgtcacacacacc
aggatgaatgaggagcagatagccacagtgtgcctgtctgtgctgaaggcactgtcagtg
ctgcacacccagggcgtcatccacagggacatcaagagtgactccatcttgctcacccac
gacggcagagtgaagctgtcagactttggcttctgcgcccaggtgtctaaagaggtccag
cggcgcaagtccctggtgggcacaccctactggatggccccagagctcatctcacgactg
ccctatgggcctgaggtggacatctggtccttgggggtgatggtgatcgagatggtggac
ggagagcccccctatttcaatgagccccccctcaaagctatgaagatgatccgtgacaac
ctaccacccaaactcaagaacttacacaaggtttctcctcttctcaagggcttcctggac
aaattgttggtgcgagaccccacccagagggcctcagccaatgagctactcaagcacccc
ttcctgagcaaggctggcccgccctcctgcattgtgcctctcatgaggcagaaccgcatg
agatga

DBGET integrated database retrieval system