KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217839
Entry
112217839         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112217839
   04068 FoxO signaling pathway
    112217839
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112217839
   04115 p53 signaling pathway
    112217839
   04218 Cellular senescence
    112217839
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112217839
NCBI-ProteinID: XP_024234193
LinkDB
Position
2
AA seq 189 aa
MAVKYNCSVLNTQSSSSVTHMKTRTTMASCKRILSSLGKSPARQNLFGPVDREQLQQEYQ
DTLRTDLEDACRRWGFDFLSDKPLAGGDFQWEEVPGTKVPLLYLPCLLSQGEAQKIRGPA
ASTGRVRAGPWHRGKENIPCTPEKYRANLQNLEKPQDKNENKLKRKQTNLTDFYQAKKRV
VGTSLKSGR
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctgttaaatacaactgcagcgttctcaatacacagtccagttcctccgttacacat
atgaaaaccagaacaaccatggccagttgtaagcgcatcctgagctctctggggaaaagt
cctgccaggcagaacctgtttggcccagttgaccgtgagcagctgcagcaggagtaccag
gacaccctgcgcacagacctggaggacgcctgtcgccgctggggcttcgacttcctgtca
gataagcctctggctgggggagacttccagtgggaagaggtaccgggcaccaaggtgcct
cttctctacctgccctgcctgttgagtcagggggaggcacagaagatcagagggccggca
gcatccacagggagggtcagggcggggccatggcaccgtggcaaggaaaacatcccttgc
acccctgagaagtacagagccaacctccagaacctggagaaaccgcaagacaagaacgag
aacaaactgaagaggaaacagaccaacctcacagatttctaccaagccaagaagagagtg
gtgggtacgtcgcttaagtcaggccggtga

DBGET integrated database retrieval system