KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217963
Entry
112217963         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217963
   04350 TGF-beta signaling pathway
    112217963
   04068 FoxO signaling pathway
    112217963
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112217963
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112217963
   04218 Cellular senescence
    112217963
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112217963
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112217963
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 112217963
NCBI-ProteinID: XP_024234352
LinkDB
Position
18
AA seq 279 aa
MERNSTNLFRAEFRALRVPNSAANRNEQRVELYQILRPDEHIAKQRYIGAKNVLTKGTPE
WVSFDVTETVREWLMYRATNLGLEISVHCPCHTFNPNGDIIDNVNEVLEVKFKGMEGEYE
ELGRWDLGRLKKKKKKKKEQKEPYLPHLILMMIPPHRLDSQPRRRKRALDTNYCFSTVEE
NCCVRRLYIDFRRDLDWKWIHEPKGYFANYCSGPCPYLRSSDTTHTQLLSLYNTLNPEAS
ASPCCVPQDLEPLTILYYSGRTPKVEQLSNMIVKSCKCS
NT seq 840 nt   +upstreamnt  +downstreamnt
atggagaggaactccaccaacctgttccgagctgagttccgtgctctcagggttccaaac
tctgctgccaataggaacgaacagagggtcgagctctaccagatcctgagaccagacgag
cacatagctaagcagcgctacatcggagccaagaacgtgctgaccaagggaacgccagaa
tgggtctccttcgacgtgacagagacggtacgggagtggttgatgtacagagcgaccaac
ctgggtctggagatcagcgtacactgcccctgccacaccttcaaccccaacggcgacatc
atcgacaatgtgaacgaagtgctggaggtcaagttcaaaggtatggaaggggagtatgag
gagctgggtcgttgggacctgggtcgtctgaagaagaagaagaagaagaagaaggagcag
aaggagccgtacctgcctcacctcatcctcatgatgatccctcctcaccgcctcgactca
cagccacgcagacgcaaacgggccctggacaccaactactgcttctccactgttgaggag
aactgctgtgtccgtcgtctctacatcgacttccgtcgagacctggactggaagtggatc
cacgagcctaaaggatactttgctaactactgctctggaccctgcccttacctgaggagc
tccgataccacacacacacagctgctgagcctgtataacactctgaacccagaggcttca
gcctctccctgctgcgttccccaggacctggagcctcttaccattctctactactctgga
cgyacccctaaagtagagcagctgtccaacatgatcgtcaaatcctgcaaatgcagctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221169
Entry
112221169         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221169
   04350 TGF-beta signaling pathway
    112221169
   04068 FoxO signaling pathway
    112221169
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112221169
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112221169
   04218 Cellular senescence
    112221169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112221169
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112221169
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112221169
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112221169
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112221169
NCBI-ProteinID: XP_024239081
LinkDB
Position
21
AA seq 430 aa
MEPSESVHQSDHRTMWLTHLALLLLRLAVSAEGLSTCQSFSLDDQKSKRIEAVRGQILSK
LRYRSPPEPPAPSPQPDTVPAEVMLLYNSTRELLKERARQAESACDRESSEEDYYAKEVQ
RIDMLPQRTDINAVNPPVPSPYYRVVGFDVSGVDRNSSNLVKAEFRIYRAPNPQARTSEQ
RVELYQVIEPEEPTGPSQRYIDSRTVRPRTKGAWLSVDVTDTVKDWLAHKERNLGLKLGV
HCPCCTFIPSTNSIVFNKSEELETRFAGLDDELLQQQVRKPGAKGQVEFSTKTPHLILTL
LPSDRVDNPGKKTRKRRAAADTTTCSRNSGAGCCLRSLYIDFRRDLNWKWIHEPKGYKAN
FCSGSCPYLWSADNHYNMILPLYNKLNPEASASPCCVPQDLEPLTIVYFMGRTPKVEQLS
NMVVRSCKCR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagccgagtgagtccgttcaccaatctgaccaccggactatgtggctgacccacctc
gccttgctgctgctccggctggcggtgtccgcggaggggctctccacctgccagtcattc
agcctggatgatcagaagtccaagcgcatcgaggccgttcgcggtcagatcctcagcaag
ctccgctaccggagcccaccggagccccccgcaccgagccctcagcccgacactgtgccc
gctgaggtgatgctgctctacaacagcactcgggagctgctgaaggagcgtgcgcgccag
gccgagtccgcgtgcgaccgggagagcagcgaggaggattattatgcaaaagaggttcag
cgcatagacatgcttccgcagcgcacagacatcaatgcagtgaaccctccagtccccagc
ccatattacagagtggtgggattcgatgtgagtggtgtggacaggaactccagcaacctg
gtcaaagctgagttcagaatctacagagcacccaacccccaggcccgcacctcagagcag
agagtagagctctatcaggtgatagagccagaagagccaacaggcccctcgcagagatac
atcgattccagaactgttcgcccacggaccaagggggcgtggctctctgtggatgtcact
gacactgtgaaggactggctggctcataaggagaggaacctgggtttgaagctgggtgtt
cactgtccatgctgcaccttcattccctccaccaacagcattgtgttcaataagagtgag
gagctggagacacgcttcgcaggtctggatgatgagctgcttcagcagcaggtgcggaag
ccgggggctaagggccaggtagagtttagtaccaagaccccccacctcatcctcaccctg
ctgcccagtgacagggtagacaacccgggcaaaaagacccgcaagaggagggctgctgca
gacaccaccacctgctccaggaattcaggcgcgggctgctgcctgcgatctctctacatc
gacttccgccgggacctgaactggaagtggatccacgagccgaagggctacaaggccaat
ttctgctctggcagctgcccatacctctggagcgctgacaaccactacaacatgatcctg
ccactgtataacaagctgaaccctgaggcgtcggcatctccgtgctgcgtacctcaggac
ctggagcctctgaccatcgtgtacttcatgggccgaacgcccaaggtagagcagctctcc
aacatggtggtcaggtcctgcaagtgccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223175
Entry
112223175         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112223175
   04350 TGF-beta signaling pathway
    112223175
   04068 FoxO signaling pathway
    112223175
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112223175
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112223175
   04218 Cellular senescence
    112223175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112223175
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112223175
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112223175
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112223175
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112223175
NCBI-ProteinID: XP_024241972
LinkDB
Position
23
AA seq 411 aa
MNYCVLSLLLTLDLATVAVSLSTCSTLDMDQFMKKRIEAIRGQILSKLKLTSPPETYPKP
EEVSRDIIAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPPYPSENVISP
THYNPYYRRLTFDVTSMEKNASNLVKAELRVFRLQNTKARVSEQRIELYQILSHKDLASP
TQRYIDSKVVRTRMEGEWLSFDVTEAVSEWLLHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELETRFAGIDDSFHHSGDLKVYRKRRHSAQAPHLLMMLLPSYRLESQHKSHRSKRA
LDAAFCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYNANFCAGACPYLWSADTQHSKV
LGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaactactgcgttttaagtcttctcctgaccttggatttagccactgtggccgtcagt
ttgtctacatgcagtacgctggacatggatcagtttatgaaaaagcgcatagaagccatc
cggggacagatactgagcaagctgaagctcacgagccccccggagacataccccaaaccc
gaggaggtgtcgcgggatatcatcgccatctataacagcacgagggacctgttgcaggag
aaagccaacgaacgggcagcaacgtgtgagcgccaacgaagcgaggaggagtactatgca
aaagaggttcacaaaatcgacatgcaacccccctacccctctgagaatgtcatctctccc
acgcactacaacccgtactacagacggctcaccttcgacgtgacctccatggagaagaat
gcctctaacctggtcaaggctgagctacgcgtcttccgcctccagaacaccaaggcccgc
gtgtctgaacagaggattgagctgtaccagattttaagtcacaaggacctggcttccccg
acgcagcgctacatcgacagcaaggtggtgcgcacgcgcatggagggggagtggctgtct
tttgatgtgacagaggcagtcagtgaatggttgcttcacagagacagaaacagtggattc
aagatcagcttgcactgtccgtgctgcacgtttgttccctcaaacaactacatcatcccc
aataagagtgaggagctggaaacccgctttgcaggtatagatgacagcttccaccacagc
ggagacctgaaggtgtataggaaacggcgccacagcgcccaggctccacacctgctcatg
atgctgctgccctcctaccgcctggagtcccagcacaagagccaccgctccaaacgagcc
ctggacgctgccttctgctccagaaatgtccaggataactgctgcttgcggtcgctctac
atcgacttcaagaaggatctgggctggcggtggatccacgagcccaagggttacaacgct
aacttctgcgccggggcctgtccctatctatggagcgctgacacccagcattccaaggtg
ctaggtctgtacaacaccatcaacccggaggcgtcagcatcgccctgctgtgtgtctcag
gatctggaacctctcaccatcctctactacatcggcaagacccccaagatagagcagctc
tccaacatgatcgtcaagtcctgcaagtgcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228884
Entry
112228884         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-1-like
  KO
K13375  transforming growth factor beta-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112228884
   04350 TGF-beta signaling pathway
    112228884
   04068 FoxO signaling pathway
    112228884
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112228884
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112228884
   04218 Cellular senescence
    112228884
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112228884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:otw03110]
    112228884
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112228884
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112228884
Chaperones and folding catalysts [BR:otw03110]
 Intramolecular chaperones
  Others
   112228884
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112228884
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112228884
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta Disaggr_repeat
Other DBs
NCBI-GeneID: 112228884
NCBI-ProteinID: XP_024250384
LinkDB
Position
30
AA seq 381 aa
MRAECLTLVALLALEYVCRNEAMSTCKSLDLELVKRKRIEAIRGQILSKLRLPKEPEIDQ
EGDSEEVPTSLMSIYNITVELSEEQVQTYIPPTRDAEEEAYFAKEVHKFNMKQSENTSKY
QMLFNMSEMRSVLGTDRLLSQAELRLLIKNRGMHDSSEQRLELYRGTGDKARYMKSHFVS
KEWANRWVSFDVTQTLREWLKGAGEEQGFQLKLPCECGKAMEEFLFEISGMNKPRGDKET
LFMNMPKPHILLMSLPVERHSQLSSRKKRQSTTEEICSDKSESCCVRKLYIDFRKDLGWK
WIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPILYY
VGRQHKVEQLSNMIVKSCKCS
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagggcagaatgtttgacgctggttgccttattggcgctggaatatgtgtgtcggaat
gaagccatgtccacctgtaagtcactggacttggagctggtgaagaggaaacgtattgag
gccatccgtggacagatactgagcaagctgcggctgcccaaggagccagagattgaccag
gagggagactctgaggaggtcccaacctccctgatgtccatctacaacatcacagtggag
ctgagtgaggagcaggtgcagacgtacataccgcccactcgggatgcagaagaggaggca
tactttgcaaaggaggtccacaagttcaacatgaaacaaagtgagaacaccagtaagtac
caaatgctcttcaacatgtctgagatgcggtctgtattggggacagatcgactgctctct
caagctgagctccgtctcctcatcaaaaatcgtggcatgcacgacagcagtgagcagagg
ctggaactctacaggggcactggagataaggcacgttacatgaagtcccattttgtctca
aaggaatgggccaatcgctgggtctcctttgatgttacacagactctgagggagtggctg
aaaggggctggagaggagcaaggattccaattgaagttgccttgtgaatgtgggaaagca
atggaagaattcctctttgaaatatcagggatgaacaagccaaggggagataaagaaact
ctcttcatgaacatgccaaagcctcacattttactgatgtcacttcctgtggaacgccac
agccagcttagctctcggaagaaacgacaaagcactactgaagagatctgctcagacaaa
tcggagagttgctgtgtgcgaaagctttacattgacttccgtaaggacctgggctggaaa
tggatccatgaacccactggctactttgctaactactgcattggcccatgcacctatata
tggaacacagagaacaagtactcccaggtactggctctgtataagcaccacaatcctgga
gcctctgcccaaccttgctgtgttccacaggtcttggagcccctacccattctctactat
gtgggtagacaacacaaggtggagcagttgtccaatatgattgttaagtcctgcaagtgt
agctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231247
Entry
112231247         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112231247
   04350 TGF-beta signaling pathway
    112231247
   04068 FoxO signaling pathway
    112231247
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112231247
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112231247
   04218 Cellular senescence
    112231247
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112231247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:otw03110]
    112231247
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112231247
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112231247
Chaperones and folding catalysts [BR:otw03110]
 Intramolecular chaperones
  Others
   112231247
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112231247
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112231247
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta Disaggr_repeat
Other DBs
NCBI-GeneID: 112231247
NCBI-ProteinID: XP_024253659
LinkDB
Position
33
AA seq 382 aa
MRAVCLMLTALLMLEYVCRSDTMSTCKSLDLELVKRKRIEAIRGQILSKLRLPKEPEIDQ
EGDTEEVPASLMSIYNSTVELSEEQVHTYIPSTHDAEEEAYFAKEVHKFNMKQSENTSKH
QMLFNMSEMRSVLGTDRLLSQAELRLLIKNHGLLDDSEQRLELYRGVGDKARYLKSHFVS
KEWANRWVSFDVTQTLNEWLQGAGEEQGFQLKLPCDCGKPMEEFSFKISGMNKLRGDTET
LAMKMPSKPHILLMSLPVERHRQPSSRKKRQTTTEEICSDKSESCCVRRLYIDFRKDLGW
KWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIY
YVGRQHKVEQLSNMIVKSCRCS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagggcagtgtgtttgatgctgactgccttattgatgctggaatatgtgtgccggagt
gacaccatgtccacctgtaagtctctggacttggaactggtgaagaggaaacgtattgag
gccatccgtggacagatactgagcaagctgcggctacccaaggagccagagattgaccag
gagggagacactgaggaggtcccagcttccctgatgtccatctacaacagcacagtggag
ctgagtgaggagcaggtgcacacgtacataccgtccactcatgatgcagaggaggaggca
tactttgcaaaggaggtccacaagttcaacatgaaacaaagtgagaacaccagtaagcac
cagatgctcttcaacatgtctgagatgcggtcagtattggggactgatcgactgctctct
caagctgagctccgtctcctcatcaaaaaccatggcctgctcgacgacagcgagcagagg
ctggaactctacagaggagttggcgataaggcacgttacctgaagtcccattttgtctcc
aaggaatgggccaatcgctgggtgtcctttgacgtaacacagactctgaatgagtggctg
caaggggctggagaggagcagggattccaattgaagttgccttgtgattgtgggaaacca
atggaggaattcagcttcaaaatatcagggatgaacaagctgaggggagatacagaaaca
ctagccatgaaaatgccatcaaagcctcacattttactgatgtcacttcctgtggaacgc
cacagacagcctagctctcggaagaaacgacaaaccactactgaagagatctgctcagat
aaatcggagagttgctgtgtgcgaagactttacattgacttccgtaaggacctgggctgg
aagtggatccatgaacccactggctactttgctaactactgcatcggcccctgcacctat
atatggaacacagaaaacaagtattcccaggtactggctctgtataagcaccacaacccc
ggagcctctgcccaaccctgctgtgttccacaggtcttggagcccctacccattatctat
tatgtggggagacaacacaaggtggagcagttgtccaatatgattgttaagtcctgcagg
tgtagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233166
Entry
112233166         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233166
   04350 TGF-beta signaling pathway
    112233166
   04068 FoxO signaling pathway
    112233166
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112233166
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112233166
   04218 Cellular senescence
    112233166
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112233166
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112233166
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112233166
NCBI-ProteinID: XP_024256370
LinkDB
Position
Unknown
AA seq 409 aa
MNLGKALLFFLLLNCVTMTLSLSTCTTVDIDHIKKKRVEAIRGQILSKLRLTSPPQTLGP
NQVPFQVLSLYNSTKELIEELGRDRQQSCGQDNTETEYYAKEIYKFNMINGPPENNDLPY
CPKGITSKVFRFNVSAMEKNSTNLFRAEFRALRVPNSSAKRNEQRIELYQILRPDDHIAK
QRYIGGKNVLTKGTPEWVSFDVTDTVREWLMYRETNLGLEISVHCPCHTFNTNGDIIENV
NEVLQVKFKGVEGDYDESRWDLGRLKKQKEQLFPHLILMMLPPHRIDAQSSSRRRKRALD
TNYCFSNYEENCCVRPLYIDFRQHLGWRWIHEPKGYYANFCSGPCPYLRSADTTHSSMLS
LYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMIVKSCKCS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaatttgggtaaagcacttctgtttttcctcctgttgaactgtgtgaccatgactttg
tcactatccacttgcaccactgtggacatagaccacataaagaaaaagagagtagaggca
atccgaggacagattctcagtaaacttcgactgaccagcccgccgcaaacattgggtccg
aatcaggtaccgtttcaggtgctatcgctctataacagtacgaaggagctgatcgaggag
ttggggagagacagacagcaaagttgtggacaggataacacggagactgaatattacgcc
aaagagatttacaagttcaatatgattaatggaccaccagaaaacaatgaccttccctac
tgccccaagggcatcacttccaaggtattccgcttcaacgtttccgccatggagaagaac
tccaccaacctcttcagagcagagttccgagcccttcgtgtccccaactccagtgccaag
aggaacgagcagcggattgagctctaccagattctgcggccagacgaccacatagctaag
cagcgctacatcgggggcaagaacgtcctgaccaaaggaacgccagagtgggtctccttc
gatgtcacagacacagtcagggaatggcttatgtaccgagagaccaacctgggcctggag
atcagtgtgcactgcccctgccacaccttcaacaccaacggtgacattatcgaaaacgtt
aatgaggtgctacaagtcaagttcaaaggtgtggagggtgactacgatgagagccgctgg
gacctgggcagactgaagaagcagaaggagcagctcttccctcatctcatcctcatgatg
ctgccccctcataggatagacgcccagtcctcatcccgcagacgcaagagagccctggac
accaactactgcttctctaactatgaggagaactgctgtgtacgacccctctacattgac
ttccgccagcacctgggctggaggtggatccatgagcctaagggatactacgctaacttc
tgctccgggccctgcccttacttacggagcgcagacaccacacacagctcgatgctgagt
ctgtacaacaccctgaaccctgaggcgtctgcctctccctgctgtgtgcctcaggacctg
gagcccctcaccatcctctactacgtgggccgcacgcccaaggtggagcagctctccaac
atgatcgtcaagtcctgcaagtgtagctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234066
Entry
112234066         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234066
   04350 TGF-beta signaling pathway
    112234066
   04068 FoxO signaling pathway
    112234066
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112234066
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112234066
   04218 Cellular senescence
    112234066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112234066
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112234066
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112234066
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112234066
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112234066
NCBI-ProteinID: XP_024257817
LinkDB
Position
3
AA seq 411 aa
MNYCVLSLLLTMDLATVAVSLSTCSTLDMDQFMKKRIEAIRGQILSKLKLTSPPETYPKP
EEVSRDIIAIYNSTRDLLQEKANDRAATCERQRSEEEYYAKEVHKIDMQPPYPSENVISP
THYNPYYRRLTFDVTSMEKNASNLVKAELRVFRLQNPKARVSEQRIELYQILSHKDLASP
TQRYIDSKVVRTRTEGEWLSFDVTEAVSEWLLHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELETRFAGIDDSFHHSGDLKVYRKRRHSAQAPHLLMMLLPSYRLESQHKSHRSKRA
LDAAFCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYNANFCAGACPYLWSADTQHSKV
LGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaactactgcgttttaagtcttctcctgaccatggatttagccactgtggccgtcagt
ttgtctacatgcagtacgctggacatggatcagtttatgaaaaagcgcatagaagccatc
cgtggacagatactgagcaagttgaagctcacgagccccccggagacataccccaagccc
gaggaggtgtcgcgggatatcatcgccatctataacagcacgagagacctgttgcaggag
aaagccaacgatcgggcggcgacgtgtgagcgccaacgaagcgaggaggagtactacgca
aaagaggttcacaaaatcgacatgcaacccccctacccctctgagaatgttatctctccc
acacactacaacccgtactacagacggctcaccttcgacgtgacctccatggagaagaat
gcctctaacctggtcaaggctgagctacgagtcttccgcctccagaaccccaaggcccgc
gtgtctgaacagaggattgaactgtaccagattttgagtcacaaggacctggcgtccccg
acgcagcgctacattgacagcaaggtggtgcgcacgcgcacggagggggagtggctgtct
tttgacgtgacagaggcagtcagtgaatggttgcttcatagagacagaaacagtggattc
aagatcagcttgcactgtccatgctgtacgtttgtgccctcaaacaactacatcatcccc
aataagagtgaggagctggaaacccgctttgcaggtatagatgacagcttccaccacagc
ggagacctgaaggtgtaccggaagcggcgccacagcgcccaggctccacacctgctcatg
atgctgctgccgtcctaccgcctagagtcccagcacaagagccaccgctccaaacgagcc
ctggatgctgccttctgctccagaaatgtccaggataactgctgcttgcggtcgctctac
atcgactttaagaaagatctgggctggaggtggatccatgagcccaagggctacaatgct
aatttctgcgccggggcctgtccctatctatggagcgctgacacccagcattccaaggtg
ctaggcctgtacaacaccatcaacccggaggcgtcagcatcgccctgctgtgtgtctcag
gatctggaacctctcaccatcctctactacatcggcaagacccccaagatagagcagctc
tccaacatgatcgtcaagtcctgcaagtgcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238812
Entry
112238812         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112238812
   04350 TGF-beta signaling pathway
    112238812
   04068 FoxO signaling pathway
    112238812
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112238812
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112238812
   04218 Cellular senescence
    112238812
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112238812
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112238812
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 112238812
NCBI-ProteinID: XP_024263113
LinkDB
Position
Unknown
AA seq 307 aa
MYLGKTLLFVLLLNCATTSLSFSTCATVDIDHVKRKRVEAIRGQILSKLRTTSPPHSLGP
SQVPYQIQALYNSTRELLEELGRDRQQSCGQDNTETEYYAKEIYKFNMVQGPPDNNDLPY
CPKGITSKVFRFNISVMERNSTNLFRAEFRALRVPNSAANRNEQRVELYQILRPDEHIAK
QRYIGAKNVLTKGTPEWVSFDVTETVQEWLMYRETNLGLEISVHCPCHTFNPNGDIIDNV
NEVLEVKFKGVEGEYEEQGRWDLGRLKKQKERSLPHLILMMIPPHRLDPQPRRRKRALDT
NYCFSTC
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtatctgggtaaaactcttctgtttgtcctactcttaaactgcgccaccacgagccta
tctttctcaacatgcgctaccgtagatatagaccatgtgaagcggaaaagggtcgaggcg
atacggggacagatactgagtaagctccggacgaccagcccgccacactcactgggaccc
agtcaggtcccctaccagatccaggccttgtataacagtacccgggagctgcttgaggag
ttggggagagaccggcagcaaagttgcggccaagacaacacggagaccgaatattatgcc
aaagagatatacaagttcaacatggtccaagggccgcctgacaacaatgaccttccatac
tgtcctaaaggaatcacttccaaagtgttccgtttcaacatctcagtgatggagaggaat
tccaccaacctgttccgagccgagttccgagctctgagggttccaaactctgctgccaat
aggaatgaacagagggtggagctctaccagatcctgaggccagacgagcacatagctaaa
caacgctacatcggagccaagaacgtgctgaccaagggaacgcccgaatgggtctccttc
gacgtgacagagacggtacaggagtggctgatgtacagagagaccaacctgggtctggag
atcagcgtacactgcccgtgccacaccttcaaccccaacggtgacatcatcgacaatgtg
aacgaggtgctggaggtcaagttcaaaggggtagaaggggagtatgaggagcagggccgt
tgggacctgggcaggttgaagaaacagaaggagcggtccctgcctcatctcatcctcatg
atgatccctcctcaccgtctggacccacagccacgtagacgcaaacgggccctggacacc
aactactgcttctccacttgttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240152
Entry
112240152         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transforming growth factor beta-1-like
  KO
K13375  transforming growth factor beta-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112240152
   04350 TGF-beta signaling pathway
    112240152
   04068 FoxO signaling pathway
    112240152
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112240152
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112240152
   04218 Cellular senescence
    112240152
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112240152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:otw03110]
    112240152
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112240152
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112240152
Chaperones and folding catalysts [BR:otw03110]
 Intramolecular chaperones
  Others
   112240152
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112240152
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112240152
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide Disaggr_repeat
Other DBs
NCBI-GeneID: 112240152
NCBI-ProteinID: XP_024264264
LinkDB
Position
Unknown
AA seq 270 aa
KNVTKHQMLFNLNEMRSSIGDYHLLSSAELRLLIKTTNIPSGSEQRLELYKGLGDSRRYL
GSRFVTNKWSDRWLAFDVTETLKEWLKGTEEEQGFELKLYCECCKPMEKFLFSIXGLDSG
VRGDVAGLAXNMRKPHILAMSIPQNYSSQLTSPRKKRAVTTGDTSQSKSLLRPKTENCCV
RKLYIDFRKDLGWKWIHQPKGYHANYCMGSCTYIWNAENKYSQILALYKHHNPGASAQPC
CVPQVLDPLPILYYVGRQHKVQVPPNPLTS
NT seq 815 nt   +upstreamnt  +downstreamnt
ataagaatgtcaccaagcaccagatgctgtttaacctgaatgagatgaggtccagcattg
gggactaccatctactctccagcgctgagctccgcctactcatcaaaaccactaacatcc
cgtctggcagtgagcagcgcctggagctctacaaggggctgggcgacagcagacgatacc
tgggatcacgcttcgtcaccaacaagtggagtgaccgctggctggctttcgacgtcactg
aaaccctcaaggaatggctgaaggggaccgaggaagagcagggctttgagttgaagctgt
actgtgagtgttgtaaacccatggaaaagttcctcttcagtatcnccgggttggacagcg
gggtacgaggtgacgtggctggtctagccnagaacatgaggaagcctcacatcttggcca
tgtccatcccccagaactacagctcacagctcacctctccgcgtaagaaacgggccgtca
ctacaggcgacacctcacagagtaagagcctgctacgtcctaaaacagagaactgttgcg
tgaggaaactctacatcgacttcaggaaagatctgggctggaagtggatccaccagccaa
aaggttaccatgccaactactgcatgggctcatgcacctacatctggaatgctgaaaaca
aatactctcagatccttgccctgtacaagcaccacaacccaggagcgtcggcccagccgt
gctgtgtaccccaggtcttggaccctctgccaatcctctactacgtagggagacaacaca
aggtacaggtaccccctaaccccctaacctcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255920
Entry
112255920         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112255920
   04350 TGF-beta signaling pathway
    112255920
   04068 FoxO signaling pathway
    112255920
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112255920
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112255920
   04218 Cellular senescence
    112255920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112255920
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112255920
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112255920
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112255920
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112255920
NCBI-ProteinID: XP_024284533
LinkDB
Position
8
AA seq 406 aa
MWFTHLALLLLRLAVSTEGLSTCKSFSLDDQKPKCIEAVRGQILSKLRYRSPQPEAVPAE
VMLLYNSTKELLKERARQSDSACDRESSEEDYYVKEVQRIDMRKQRTDTNAVNPPVPSPY
YRLVGFDVSVVDRNSSTLVKAEFRIYRTPNPQTRTSEQRVEIYQLLPPTEEATGPSQRYI
HSRTVRPRTKGAWLSVDVRHCDGLAGSERNLGLKLGVHCPCCTFVPSTNSMVFNKSEELD
AASLVCCLDDELLQQQLRRPGSGLAKGQVDFSTKTPHVILTLRPSDRVDNPGKMTRKKRA
TADTTTCSRNSDVDCCLRSLYIDFRQDLDWKWIHEPKGYKGCPYLWSADNHYNMILPLFN
KLNPEASASPCCVPQDLEPLTIVYIMGRTPKVKQLSNMVVRSCRCR
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtggtttacccacctcgccctgctgctgctccggctggcggtgtccaccgaggggctc
tccacctgcaagtctttcagcctggatgatcagaaacccaagtgcatcgaggccgtccgc
ggccagatcctcagcaaactccgctaccggagcccacagcccgaggccgtacccgccgag
gtgatgctactctacaacagcaccaaagagctgttgaaggagcgtgcgcgtcagtccgat
tccgcgtgcgaccgagagagcagcgaggaggattattatgtaaaagaggttcagcgcata
gacatgcgtaagcagcgcacggacacaaatgcagtgaaccctcccgtccccagcccgtat
tacagactggtggggttcgatgtgagtgttgtggacaggaactccagcaccctggtcaaa
gctgagttcagaatctacaggacaccaaacccccagacccgcacctcagagcagagagta
gagatctatcagcttctacccccaacagaagaggcaaccggtccttcgcagagatacatc
cactccagaacggttcgcccacggaccaagggggcgtggctctcggtggatgtcagacac
tgtgacggactggctggctcagagaggaacctggggttgaagctgggtgttcactgtccg
tgctgcaccttcgttccctccaccaacagcatggtgttcaataagagcgaggagctggat
gccgcgtcactggtctgctgtctggatgatgagctgcttcagcagcagttgcggaggcca
gggtcagggctggctaagggccaggtagattttagtaccaagaccccccacgtcatcctc
accttaaggcccagcgacagggtcgacaacccaggcaagatgacccgcaagaagagggcc
accgcagacaccaccacctgctccaggaactctgacgtggactgctgtctgcgatctctc
tacatcgacttccgccaggacctggactggaagtggatccatgagccgaagggctacaag
ggctgcccatacctctggagtgctgacaaccactacaacatgatcctgccgctgtttaac
aagctgaaccctgaggcgtcggcatctccgtgctgcgtacctcaggacctggagcctctg
accatcgtgtacatcatgggccgaacgcccaaggtaaagcagctctccaacatggtggtc
aggtcctgcaggtgccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256698
Entry
112256698         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256698
   04350 TGF-beta signaling pathway
    112256698
   04068 FoxO signaling pathway
    112256698
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112256698
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112256698
   04218 Cellular senescence
    112256698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112256698
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112256698
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112256698
NCBI-ProteinID: XP_024285894
LinkDB
Position
8
AA seq 410 aa
MHLGKALLFFLLLNCVTMTLSLSTCTTVDIDHIKKKRVEAIRGQILSKLRMTSPPQTVGP
NQVPFQVLALYNSTKELIEELGRDRQQSCGQDNTETEYYAKEIYKFNMINGPPENNDLPY
CPKGITSKVFRFNVSAMEKNSTNLFRAEFRALRVPNSSAKRNEQRIELYQILRPDDHIAK
QRYIGGKNALTKGMPEWVSFDVTDTVREWLMYRETNLGLEISVHCPCHTFNPNGDIIENV
NEVLDVKFKGVEGDYDESRWDLGSRLKKQKEQLFPHLILMMLPPHRLDAQSSSRRRKRAL
DTNYCFSNYEENCCVRPLYIDFRQHLGWRWIHEPKGYYANFCSGPCPYLRSADTTHSSML
SLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMIVKSCKCS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgcatttgggcaaagcacttctgtttttcctcctgttgaactgtgtgacaatgactttg
tcactatccacttgcaccactgtggacatagaccacataaagaaaaagagagtagaggca
atccgaggacagattcttagtaaacttcgaatgaccagcccgccgcaaacagtgggtccg
aatcaggtaccgtttcaggtgctggcgctctataacagtacgaaggagctgatcgaggag
ttggggagagacagacagcaaagttgtggacaggataacacggagactgaatattacgcc
aaagagatttacaagttcaatatgattaatggaccaccagaaaacaatgaccttccctac
tgccccaagggcatcacctccaaggtgttccgcttcaatgtctcggccatggagaagaac
tccaccaacctcttcagagccgagttccgagcccttcgtgtccccaactctagcgccaag
aggaacgagcagaggattgagctctaccagatcctgcggccagacgaccacatagccaag
cagcgctacatcgggggcaagaacgccctgaccaaaggaatgccagagtgggtctccttc
gatgtcacagacacagtcagggaatggctcatgtaccgagagaccaacctgggcttggag
atcagtgtgcactgcccctgccacaccttcaaccccaatggtgacatcatcgaaaatgtc
aacgaggtgctagatgtgaagttcaaaggtgtggagggtgactacgatgagagtcgctgg
gacctgggtagcagactgaagaagcagaaggagcagctcttccctcacctcatcctcatg
atgctgccccctcacaggctagacgcccagtcctcatcccgcagacgcaagagagccctg
gacaccaactactgcttctctaactatgaagagaactgctgtgtgcgacccctctacatt
gacttccgccagcatctgggctggaggtggatccacgagccgaagggatactatgccaac
ttctgctccgggccctgcccttacctacggagcgcagacaccacacacagctcgatgctg
agtctgtacaacaccctgaaccctgaggcgtctgcctctccctgctgtgtgcctcaggac
ctggagcccctcaccatcctctactacgtgggccgcacccccaaggtggagcagctctcc
aacatgatcgtcaagtcctgcaagtgcagctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261788
Entry
112261788         CDS       T05605                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112261788
   04350 TGF-beta signaling pathway
    112261788
   04068 FoxO signaling pathway
    112261788
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112261788
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112261788
   04218 Cellular senescence
    112261788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112261788
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112261788
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112261788
NCBI-ProteinID: XP_024293162
LinkDB
Position
11
AA seq 409 aa
MNLGKALLFFLLLNCVTMTLSLSTCTTVDIDHIKKKRVEAIRGQILSKLRLTSPPQTLGP
NQVPFQVLSLYNSTKELIEELGRDRQQSCGQDNTETEYYAKEIYKFNMINGPPENNDLPY
CPKGITSKVFRFNVSAMEKNSTNLFRAEFRALRVPNSSAKRNEQRIELYQILRPDDHIAK
QRYIGGKNVLTKGTPEWVSFDVTDTVREWLMYRETNLGLEISVHCPCHTFNTNGDIIENV
NEVLQVKFKGVEGDYDESRWDLGRLKKQKEQLFPHLILMMLPPHRIDAQSSSRRRKRALD
TNYCFSNYEENCCVRPLYIDFRQHLGWRWIHEPKGYYANFCSGPCPYLRSADTTHSSMLS
LYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMIVKSCKCS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaatttgggtaaagcacttctgtttttcctcctgttgaactgtgtgaccatgactttg
tcactatccacttgcaccactgtggacatagaccacataaagaaaaagagagtagaggca
atccgaggacagattctcagtaaacttcgactgaccagcccgccgcaaacattgggtccg
aatcaggtaccgtttcaggtgctatcgctctataacagtacgaaggagctgatcgaggag
ttggggagagacagacagcaaagttgtggacaggataacacggagactgaatattacgcc
aaagagatttacaagttcaatatgattaatggaccaccagaaaacaatgaccttccctac
tgccccaagggcatcacttccaaggtattccgcttcaacgtttccgccatggagaagaac
tccaccaacctcttcagagcagagttccgagcccttcgtgtccccaactccagtgccaag
aggaacgagcagcggattgagctctaccagattctgcggccagacgaccacatagctaag
cagcgctacatcgggggcaagaacgtcctgaccaaaggaacgccagagtgggtctccttc
gatgtcacagacacagtcagggaatggcttatgtaccgagagaccaacctgggcctggag
atcagtgtgcactgcccctgccacaccttcaacaccaacggtgacattatcgaaaacgtt
aatgaggtgctacaagtcaagttcaaaggtgtggagggtgactacgatgagagccgctgg
gacctgggcagactgaagaagcagaaggagcagctcttccctcatctcatcctcatgatg
ctgccccctcataggatagacgcccagtcctcatcccgcagacgcaagagagccctggac
accaactactgcttctctaactatgaggagaactgctgtgtacgacccctctacattgac
ttccgccagcacctgggctggaggtggatccatgagcctaagggatactacgctaacttc
tgctccgggccctgcccttacttacggagcgcagacaccacacacagctcgatgctgagt
ctgtacaacaccctgaaccctgaggcgtctgcctctccctgctgtgtgcctcaggacctg
gagcccctcaccatcctctactacgtgggccgcacgcccaaggtggagcagctctccaac
atgatcgtcaagtcctgcaagtgtagctaa

DBGET integrated database retrieval system