KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218034Help
Entry
112218034         CDS       T05605                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00020  Citrate cycle (TCA cycle)
otw00190  Oxidative phosphorylation
otw01100  Metabolic pathways
otw01200  Carbon metabolism
Module
otw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
otw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
otw_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112218034
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112218034
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112218034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 112218034
NCBI-ProteinID: XP_024234409
LinkDB All DBs
Position
2
AA seq 294 aa AA seqDB search
MQREVRVTLLKMSVVCLSSLGRCSAVAFRSSAGMVAVRYAQTAAATAPQPRIKKFQVYRW
DPDTVGDKPRMQTFDIDLNTCGPMVLDALIKIKNEMDGTLTFRRSCREGICGSCAMNING
GNTLACLNKIDTNTSKATKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDETNEGK
EQYHQTVEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFT
EERLSKLQDPFSLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKSASA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgagaggtcagagtaacgttgctcaagatgtcggtcgtttgtctctcgtccttg
ggtcgctgtagcgccgtggcattccgatcttccgccggaatggtggcggttcggtatgcc
cagacagcagcggccacagccccacagcctagaatcaagaagttccaggtgtaccgctgg
gacccagacacagttggtgacaagccccgcatgcagacctttgacattgacctcaacacc
tgtggccccatggtattagacgccctcatcaagatcaagaacgagatggacggcactctg
actttccgtcgctcctgcagagagggtatctgtggatcctgtgcaatgaacatcaatgga
ggcaacacactggcctgcctcaacaagattgacaccaacaccagcaaggctaccaagatc
taccctctgccacacatgtacgtggtcaaggacctggtgcctgatatgagtaatttctat
gctcagtacaagtcgatcgagccctacctgaagaagaaagatgagacaaatgagggaaag
gaacaataccatcagactgtggaggacagacaaaaactggacgggctgtatgaatgtatc
ctgtgtgcgtgctgcagcaccagctgtcccagctactggtggaatggagacaagtacttg
ggacctgctgtcctcatgcaggcctatcgttggatgatcgactcgcgagacgagttcaca
gaggagcgtctttccaaactgcaggatcctttctctctctaccgctgtcacactatcatg
aactgcactaagacctgccccaagggccttaacccagggaaggcgattgcagagattaag
aagatgatggccacttacaaggagaagaaatcagcttctgcttga

DBGET integrated database retrieval system