KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218060Help
Entry
112218060         CDS       T05605                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 1E-like
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112218060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112218060
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    112218060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 112218060
NCBI-ProteinID: XP_024234426
LinkDB All DBs
Position
18
AA seq 373 aa AA seqDB search
MEMERYHGDSSTGPNITNSTGAPASALPAVLVTDRMVVLVVLLGLLTLLTALVNGAVITA
ICTTKKLHLPANYLICSLAFTDFLVSILVMPVSILYIATETWSLGQVVCEAWLSVDMTCC
TCSILHLCVIALDRYWAITKAIEYARKRSARRAAVMVGIIWVISVFISIPPLFWRYRPGS
HGPKQCIIQHNHVGYTIYSTFGAFYIPMTLILILYYRIYNAAKTLYQKRVSSRHLSSQNS
LNHCRVAHTFCVSDLSTSDPTLEFDRLNVTIRIPSFETEMEAADERHQICTSRERKAARI
LGLILGAFILCWMPFFLKELLVGLQVITATPHVSDFLTWLGYFNSLINPLLYTSFNEDFK
LAFKKLLRRKEHA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaaaggtaccatggggacagctccacagggcccaacatcaccaacagcaca
ggagccccagccagcgctctcccagcggtgctggttacagacaggatggtggtgctggta
gttctactagggctcctcaccctcctcactgcgctggtcaacggtgccgtcatcacagcc
atctgcaccaccaagaagctccacctacctgccaactacctcatctgctcgctggcgttc
acagactttctggtgtctatcctggtgatgccagtcagcatcctctacatcgccacagag
acctggtcattgggccaggtggtgtgtgaggcctggctgagcgtggacatgacttgctgc
acctgctccatcctgcacctgtgtgtcatagcgctggaccgctactgggctatcaccaag
gccatcgagtacgcccgcaagaggtcggcccgccgggcagctgtcatggtgggcatcatc
tgggtcatctcagtcttcatatctataccgcccctcttctggagatacaggcccggtagc
catggcccaaaacagtgcatcatacagcacaaccatgtgggctacaccatttactccact
tttggggcattttacatccccatgacccttattctcatattgtactataggatttacaat
gccgcaaagacactttaccagaaacgggtctcgtcgcggcacctgagcagccagaactct
ctaaaccactgccgtgtggcacacaccttctgtgtatcggacctgtccacctcggacccc
actctggagtttgacaggctcaatgtcaccatccgtatcccctcatttgagacagagatg
gaggcggcagatgagaggcaccagatctgtacctcccgggagaggaaggcagcacgtatc
ctgggcctcatcctcggggcttttatcctctgctggatgcctttctttctgaaggagctt
cttgtaggcttacaggtcataactgccacgccacatgtatctgacttcttaacctggctg
ggctacttcaactcactcattaaccctctcctttacaccagcttcaatgaggattttaag
ttggcctttaagaaactgctcagacgaaaggagcatgcatag

DBGET integrated database retrieval system