KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218162
Entry
112218162         CDS       T05605                                 

Gene name
parvb
Definition
(RefSeq) beta-parvin isoform X1
  KO
K06275  parvin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218162 (parvb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112218162 (parvb)
   04147 Exosome [BR:otw04147]
    112218162 (parvb)
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112218162 (parvb)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112218162 (parvb)
SSDB
Motif
Pfam: CH DUF1938 4HBT
Other DBs
NCBI-GeneID: 112218162
NCBI-ProteinID: XP_024234507
LinkDB
Position
19
AA seq 365 aa
MAGAPVRSATSQSGKMKKDESFLGKLGGTLVRKKKSKEVSDLHEEGKNAINTPMLPSGTE
IHPEDTMLEENAERNMLDPTSRENPKFKDLQRVLIDWINNELEEDRIIVKGLEEDCYDGQ
VLQKLFEKLSGRKLNVAEVTQSEIGQKQKLQTVLEAVNELLRPHGWSIEWSVDSIHAKNL
VAIVYLLVALAMHYLAPIRLPEHVSVQVVVVKKREGILQTSHVTKELTSTTEMMMGRFER
DAFDTLLDHAPDKLNVVKKSLVTFVNKHLNKLNLEVTELESQFADGVYLVLLMGLLENYF
VPLYNFFLTPENFEQKVHNVAFAFELMQDGGLKKPKARPEDVVNLNLKSTLRVLYNLFTN
YKNSE
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggctggagctcctgttaggtcagcgacttcgcagtcaggcaagatgaaaaaggacgaa
tctttccttggaaaattaggaggaacgctggttagaaagaagaagtccaaagaagtgagt
gaccttcatgaggaggggaagaatgccatcaacactcccatgctgccctctgggactgaa
atccaccctgaggacaccatgctggaagagaatgctgagaggaacatgctggatccgacc
tcaagggagaatccaaaattcaaagatcttcagagggtattgatagactggatcaacaat
gagctggaagaggacaggatcatcgtcaaaggcttggaggaggattgctatgatggacag
gtgcttcagaaattatttgagaagctgtctgggcgtaagctgaacgtggctgaggtgacc
cagtcagagataggacagaaacagaagctccagacggtactggaggccgtcaacgagctg
ctccggcctcacggctggtccatcgagtggagcgtcgactctatccatgctaagaacctg
gtggccatagtgtacctgctggtggctctggccatgcactacctggcccccatcagactg
ccagagcacgtctctgtacaggtggtggtggtcaagaaaagagaaggcatactgcagacg
tctcatgtgactaaggagctgacgagcactacagagatgatgatgggtagatttgaaagg
gatgcatttgacaccctcctggatcatgcaccggacaagctcaacgttgtgaagaagtcc
ctcgtcacctttgtgaacaaacacctgaacaagctgaacctggaggtcacggagttggaa
tcccagtttgctgatggtgtgtacctggtgctgctgatgggactgctggagaactacttt
gtccccctctacaacttcttcctcacaccagagaactttgagcagaaggttcacaacgtg
gcgtttgcctttgaactaatgcaggacggaggcctaaagaaacccaaagccaggccggaa
gacgttgtgaacttgaacctgaagtctaccttgagggtgttgtacaacctgttcaccaac
tataagaactccgagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218163
Entry
112218163         CDS       T05605                                 

Gene name
parvg
Definition
(RefSeq) gamma-parvin
  KO
K06275  parvin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218163 (parvg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112218163 (parvg)
   04147 Exosome [BR:otw04147]
    112218163 (parvg)
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112218163 (parvg)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112218163 (parvg)
SSDB
Motif
Pfam: CH CAMSAP_CH
Other DBs
NCBI-GeneID: 112218163
NCBI-ProteinID: XP_024234511
LinkDB
Position
19
AA seq 319 aa
MEDFPDMYQGKDPEDIESFQGERRKIIQPTSLKDPKLEKLKSVLVNWINSTLKEEHIVVQ
SLEEDIFDGLILHHLLGRLAGVLLSVDEIAVTSAAQTRKLEVILEALNEKLGLQDSSLSR
WSVKLIHSKDLLATLHLLVAMVRCFQPNLELPPNVRVEVVLLEVNRSGIKSEKEIEILTD
ESDSATDALSSSDSEDPIEQLLKLEPHKINTVKRAIMHFVNKKMSTLGLQVTDMEKQFSD
GVILLLLIGQLEGFFVPLYDFNITPVNATEMLQNVTVALDLLNDIGLPTTNIEPQDIVSQ
DVTATLKVLYALFKKHKSR
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaggattttcctgatatgtaccaggggaaagaccctgaggacattgaatctttccag
ggtgagaggaggaagatcattcagccgacatctttgaaagatcccaaacttgaaaagctg
aaatcggttttggttaactggatcaacagtactttgaaagaggaacacatcgtagtgcag
agtctggaagaggatatctttgatggcctaatcctccatcacctccttgggaggttagct
ggagtgcttctgtctgtggatgagatagcggtgaccagcgctgctcagacacgcaagctg
gaggtcatcctggaggccctgaatgagaaactggggctacaggacagctctctcagcagg
tggagtgtcaaactcatccacagcaaagacttgctggccacactccatcttctggttgcc
atggtgaggtgcttccagcctaatctggagcttcccccaaatgtcagagtggaagttgtc
ttgttggaggtcaacagaagtggaatcaaatcagaaaaggaaatagagattcttacagat
gaaagcgattcagctaccgacgccctgagcagctcagacagcgaggatcccattgagcag
ctgctgaagctggaaccccacaagatcaacacagtaaagcgggccatcatgcactttgtc
aacaagaagatgtcaaccttgggactacaggtgacagacatggagaaacagttttcagat
ggtgttatactccttctgctgattggacagttggagggcttctttgttccactctatgac
ttcaacatcaccccagtcaatgctactgagatgctgcagaatgtgaccgtggccctggac
ctcctgaatgacatagggctacccacgaccaacattgagccccaagatatagtctctcag
gatgtgacagctaccttgaaggtcctatatgccctgttcaagaagcacaaaagcagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249152
Entry
112249152         CDS       T05605                                 

Definition
(RefSeq) alpha-parvin-like
  KO
K06275  parvin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249152
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112249152
   04147 Exosome [BR:otw04147]
    112249152
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112249152
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112249152
SSDB
Motif
Pfam: CH CH_2 CAMSAP_CH FHIPEP FlaG
Other DBs
NCBI-GeneID: 112249152
NCBI-ProteinID: XP_024274609
LinkDB
Position
4
AA seq 372 aa
MASSPQKSPSSPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLEGERLNVAEVTQSEIAQKQKLQTVLEKINDTLKVSIRNIKWTID
SVHAKSIVAILHLLVALSQHCRAPIRLPDHVSIQVVVVQKREGILQSRQVQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDTQFADGVYLVLLM
GLLEGYFVPLFNFFLTPEHFDQKVHNVAFSFELMQDGSLEKPKPRAEDIVNCDLKSTLRV
LYNLFTKYRNVE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcttcttcgccacagaaatcaccttcttctcccaaatctccgactccaaaatcacca
ccttcaagaaaaaaagatgactctttcctcggaaaacttgggggaactttggccagaaga
aaaaaggcaaaagaagtgtctgagctccaggaggagggcatgaatgccatcaacctgcca
ctcagccccatcccctttgagctggacccagaggacaccatgctggaggagaatgaggtc
cgcaccatggttgaccctaactccaggaatgaccccaaactgcaagaactgatgaaggta
ctcatagactggatcaatgatgtgctggtgggggagagaatcattgtcaaagacctggct
gaggacctctacgatgggcaggttctgcagaaactctttgagaagctggagggtgagcgg
ctgaatgtggctgaggtgacccagtctgagatagcccagaagcagaagttgcagacagtt
ctggagaagatcaacgacactctgaaggtctcaatcagaaacatcaaatggaccattgac
tctgtccatgctaaaagcatcgtagccattctccatttattggtggcgctgtctcagcac
tgccgcgcccccatccgcctacctgatcatgtgtccattcaagttgtggttgtacagaaa
cgggaggggatcctgcagtctcgccaggttcaggaagagatcacagggaacacggaggct
ctatcaggaagacatgagcgagatgcgtttgacactttgtttgaccatgcaccagacaag
ctgaatgtggtgaaaaagactctgatcacctttgtgaacaagcacttgaacaagttgaac
ctggaggtgtctgaattggacacacagtttgctgatggtgtgtacctggtgttactgatg
ggactgcttgagggctactttgttcctctcttcaacttcttcctaacgccagagcatttt
gaccaaaaggtgcacaatgtggctttctcctttgagctgatgcaagatggcagcctggag
aaacccaagccacgggcagaggatattgtgaactgtgacctgaagtctactctgagggta
ctctacaacctcttcaccaaatacagaaatgtggaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252602
Entry
112252602         CDS       T05605                                 

Definition
(RefSeq) alpha-parvin-like
  KO
K06275  parvin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112252602
   04147 Exosome [BR:otw04147]
    112252602
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112252602
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112252602
SSDB
Motif
Pfam: CH CAMSAP_CH FlaG
Other DBs
NCBI-GeneID: 112252602
NCBI-ProteinID: XP_024279748
LinkDB
Position
6
AA seq 372 aa
MATSPQKSPSSPSPTTPKSPSSRKKDDSFLGKLGGTLVRRKKAKEVSELQEEGMNAINLP
LSPTQYELDPEDTMLEENEVRTMVDPNSKNDQKLQELQKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLERINDSIKVSARSIKWNVD
SVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVAELDTQFADGVYLVLLM
GLLEGYFVPLYNFFLTPENFEQQVHNVSFSFELMQDGGLERPKPRPEDIVNCDLKSTLRV
LYNLFTRYRNVE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctacttcgccgcaaaagtcgccatcctctccgtcgccgacgactccgaaatcaccc
tcttccagaaagaaagatgactcgttcctgggaaaacttggaggaactttagtaagaaga
aagaaggcaaaagaagtgtctgagctccaggaagaggggatgaacgccatcaacctgccc
ttgagtcccacccaatacgaactggacccagaagacaccatgctagaggagaatgaggtc
cgcaccatggtcgaccccaactccaagaacgaccagaaactacaggaactccagaaggtg
ttgatcgactggatcaatgatgtgttggtgggggagaggatcatcgtgaaggacctggct
gaggatctatacgatgggcaggttctgcagaaactctttgagaagctggagggggagaag
ctaaacgtagctgaggtgacccagtcggagatcgcccagaaacagaaactacagacggtg
ctggagaggatcaacgactccatcaaggtctctgccaggagcatcaaatggaacgtggac
tcggtccatgctaaaagtatagtggccattcttcacctgttggtggcgctatctcagcac
ttcagagcaccaatcagacttcctgatcacgtgtccatccaagtagtggtggttcagaaa
agggaggggattctgcaatctcgtcagatccaggaggagatcacgggcaatacagaggct
ttatctggcagacatgagcgagatgctttcgacaccctgtttgatcacgctccagacaag
ctcaatgtggtaaaaaagactctcatcacctttgtgaacaaacacttgaacaaactcaat
ctggaggtggctgaactggacacacagtttgctgacggtgtgtaccttgttctgctgatg
ggattgctggagggctactttgttccactctataatttcttcctgactcctgagaacttt
gaacaacaggtgcacaacgtgtccttctcttttgagctgatgcaagacggaggtttggag
agacccaaacctagacctgaagatatcgtgaactgtgacctcaagtcaaccctgagggtg
ctgtacaacctcttcaccaggtacagaaacgtggagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263678
Entry
112263678         CDS       T05605                                 

Definition
(RefSeq) alpha-parvin
  KO
K06275  parvin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263678
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112263678
   04147 Exosome [BR:otw04147]
    112263678
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112263678
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112263678
SSDB
Motif
Pfam: CH CH_2 CAMSAP_CH FHIPEP FlaG
Other DBs
NCBI-GeneID: 112263678
NCBI-ProteinID: XP_024295949
LinkDB
Position
12
AA seq 372 aa
MASSPQKSPSSPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLEGERLNVAEVTQSEIAQKQKLQTVLEKINDTLKVSIRNVKWTID
SVHAKSIVAILHLLVALSQHCRAPIRLPDHVSIQVVVVQKREGILQSRQVQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDTQFADGVYLVLLM
GLLEGYFVPLFNFFLTPEHFDQKVHNVSFSFELMQDGGLEKPKPRAEDIVNCDLKSTLRV
LYNLFTKYRNVE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcttcttcgccacagaaatcaccttcttctcccaaatctccgactccaaaatcacca
ccttcaagaaaaaaagatgactctttcctcggaaaacttgggggaactttggccagaaga
aaaaaggcaaaagaagtgtctgagctccaggaggaggggatgaatgccatcaacctgccg
ctcagccccatcccctttgagctggacccagaggacaccatgctggaggagaatgaggtc
cgcaccatggttgaccctaactccaggaatgaccccaaactgcaagaactgatgaaggta
ctcatagactggatcaatgatgtgctggtgggggagagaatcattgtcaaagacctggct
gaagacctctacgatgggcaggttctgcagaaactatttgagaagctggagggtgagcgg
ctgaatgtggctgaggtgacccagtctgagatagcccagaagcagaagctgcagacagtt
ctggagaagatcaacgacactctgaaggtctcaatcagaaacgtcaaatggaccattgac
tctgtccatgctaaaagcatcgtggccattctccatttattggtggcgctgtctcagcac
tgccgcgcccccatccgcctacctgatcatgtgtccattcaagttgtggttgtacagaaa
cgggaggggatcctgcagtctcgccaggttcaggaagagatcacagggaacacggaggct
ctatcaggaagacatgaacgagatgcgtttgacaccttgtttgaccatgcaccagacaag
ctgaatgtggtgaaaaagactctgatcacctttgtgaacaagcacttgaacaagttgaac
ctggaggtgtctgaattggacacacagtttgctgatggtgtgtacctggtgttgctgatg
ggactgcttgagggctactttgttcctctcttcaacttcttcctaacgccagagcatttt
gaccaaaaggtgcacaatgtgtctttctcctttgagctgatgcaagatggaggcctggag
aaacccaagccacgggcagaggatattgtgaactgtgacctgaagtcgactctgagggta
ctctacaacctcttcaccaaatacagaaatgtggaataa

DBGET integrated database retrieval system