KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218171
Entry
112218171         CDS       T05605                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112218171 (cdkn1b)
   04068 FoxO signaling pathway
    112218171 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112218171 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112218171
NCBI-ProteinID: XP_024234522
LinkDB
Position
19
AA seq 182 aa
MSNVRVSNGSPTFERTDARFSDHPKPSACRNLFGPVDHEELRRDLKGHLQEIEETSSAKW
NFDFSSQTPLLNGRFEWELVDSKDIPRFYSRTQRSAKGLCPSGNNNVDLNGNSCVTPPQP
SENTERSESKEQCTGQRKRPASHDLSSQNKRSHSSSDENTRCPALAHSVEHTPLKTSPRT
QT
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgtgtttcaaatgggagccctacatttgaaaggaccgatgctcggttt
tcggatcaccccaaaccgtcagcctgcaggaaccttttcggcccggtggatcacgaagag
ttaaggagggatttaaagggacatttgcaagagattgaagagacgtcctcagcgaaatgg
aacttcgatttttcaagtcaaacacccctattaaacgggagattcgaatgggaattagtg
gatagtaaagacattccacgtttctacagcagaactcaacgatcggcaaagggcctttgc
ccctctgggaataataatgtggatcttaatgggaatagttgtgtgactccaccgcagcct
tctgaaaacacagaaaggtcggagagcaaagagcagtgcaccgggcagagaaaaagacca
gcctcccatgacctctcgtcccaaaataaaaggtcacacagcagttcggatgaaaatact
cgttgcccagccttggcgcattctgtagaacatacacccttgaaaaccagtcccaggact
caaacgtga

DBGET integrated database retrieval system