KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218377
Entry
112218377         CDS       T05605                                 

Definition
(RefSeq) catalase isoform X1
  KO
K03781  catalase [EC:1.11.1.6]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00380  Tryptophan metabolism
otw00630  Glyoxylate and dicarboxylate metabolism
otw01100  Metabolic pathways
otw01200  Carbon metabolism
otw04068  FoxO signaling pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    112218377
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    112218377
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112218377
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112218377
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     112218377
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 112218377
NCBI-ProteinID: XP_024234882
LinkDB
Position
19
AA seq 524 aa
MADYRGKATDQMKLWKEGRSAQRPDTLTTGAGHPVGDKLNIMTTGPQGPLLVQDTPFIDE
MSHFDRERIPERVVHAKGGGAFGYFEVTHDISRYCKAKVFEHVGKTTPIAVRFSTVAGES
GSADTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDAMLFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPECMHQVSFLFSDRGLPDGFRHMNGYGSHTFKLVNAEGQPVYCKFHYKTDQ
GIKNMKPEDAEHLASTDPDYAIRDLYTSIANGNFPSWSFYIQVMTFEQAEKFQWNPFDLT
KVWSHKEYPLIPVGRLVLNRNPANYFAEIEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPD
THRHRLGANYLQLPVNCPFRTRVANYQRDGPMCMLDNQAGAPNYFPNSFSAPETQPQHVE
TRFKVSPDVGRYNSTDDDNVTQVRTFFTKVLNEEERQRLCQNMAGALKGAQVFIQKRWVQ
NLMAVHADYGNGVQALLNNADPKKDAVRVYTRGGAAAITASSKM
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggctgattatagagggaaagcaaccgatcaaatgaagctatggaaagagggccgaagc
gctcagaggccagacaccctgaccacaggggctggtcacccggtaggggacaagctgaat
ataatgaccacaggtccccaggggcccctcctggtgcaggacaccccgttcatagatgag
atgtcacacttcgaccgtgagcgcatcccagagagggtggttcacgccaagggaggcgga
gcgttcgggtactttgaggtgacacatgacatctctcgctactgcaaggccaaggtgttt
gagcatgtgggaaagaccacacctatcgccgtccgcttctccaccgtggctggggaatcg
ggctcagccgacacagtgagagacccacgtggctttgcagtcaagttctacactgacgag
ggcaactgggaccttactggcaacaacacccccatattctttatcagggacgctatgctg
ttcccatcctttatccactctcagaagcgcaacccccagactcacctaaaggacccagac
atggtgtgggacttctggagcctgcggcctgagtgtatgcatcaggtgtccttcctgttc
agtgaccgtggtctgcctgacggcttccgccacatgaacggctacggctcccacaccttc
aagctggtcaacgccgagggtcagcccgtctactgcaagttccattacaagaccgaccag
ggcatcaagaacatgaaacctgaggatgccgagcacctggcttccaccgacccggactat
gccatccgagacctttacacctccatcgccaacggcaacttcccctcctggtccttttac
atccaggtcatgacctttgagcaggcagagaagttccagtggaacccctttgacctgacc
aaggtgtggtctcacaaggagtaccccctcattcctgtggggaggttggtgctcaacaga
aaccctgccaactactttgctgagatcgagcagctagcctttgaccccagcaacatgccc
ccaggcatcgagcccagccctgacaagatgctgcaggggcgtctgttctcctacccagac
acacaccggcaccggctgggcgccaactacctgcagctgcccgtcaactgccccttcagg
acccgtgtggccaactaccagcgagacgggcccatgtgcatgttggacaaccaggctggc
gctcccaactacttccccaacagcttcagtgctccagagacccaaccccagcacgtggag
accaggtttaaggtgtccccagatgtgggccgctacaacagtactgacgacgataacgtc
acacaggtgcgtaccttcttcactaaggtgctgaacgaggaggagcgccagaggctttgt
cagaatatggctggtgccctgaagggagcccaagtcttcatccagaaacgctgggttcag
aacctgatggctgtgcatgcagactatggaaacggggtccaggccctactcaacaatgct
gaccccaagaaggacgctgtgagagtgtatacccgtggaggtgcagctgccatcactgcc
tcctccaagatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230404
Entry
112230404         CDS       T05605                                 

Definition
(RefSeq) catalase-like
  KO
K03781  catalase [EC:1.11.1.6]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00380  Tryptophan metabolism
otw00630  Glyoxylate and dicarboxylate metabolism
otw01100  Metabolic pathways
otw01200  Carbon metabolism
otw04068  FoxO signaling pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    112230404
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    112230404
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112230404
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112230404
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     112230404
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 112230404
NCBI-ProteinID: XP_024252462
LinkDB
Position
32
AA seq 524 aa
MDGDRGKANDQMKLWKEGQSDTRPDNLTTGAGHPIGDKLNIITAGPRGPLLVQDTPFIDE
MAHFDRERIPERVVHAKGGGAFGYFEVTHDISRYCKAKVFEHVGKTTPVAIRFSTVAGES
GSADTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDAMLFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPECMHQVSFLFSDRGLPDGFRHMNGYGSHTFKLVNADSQPVYCKFHYKTNQ
GIKNMKPEDAERLASTDPDYAIRDLYTSIANGKFPSWSFYIQVMTFDQAEKFQWNPFDLT
KVWSHKEYPLIPVGRLVLNRNPANYFAEIEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPD
THRHRLGTNYLQLPVNCPFRTRVANYQRDGPMCMFDNQAGAPNYFPNSFSAPETQQQHVE
TRFKVSPDVGRYNSADDDDVTQVRTFFTEVLNEEERQRLCQNMAGALKGAQVFIQKRWIQ
NLMAVHADYGNGVQALLNNTEPTKDTVRVYTRGGASAVAASSKM
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggacggggatagagggaaagcaaacgatcaaatgaagttatggaaagagggccaaagc
gatacgaggccagacaacctgaccactggggctggtcacccgataggggacaagctgaat
ataataacagcgggtccccgggggcccctcctagtgcaggacaccccgttcatagacgag
atggcccacttcgaccgcgagcgcatcccagagagggtggtacatgccaagggaggcgga
gcttttgggtactttgaggtgacacatgacatctctcgctactgcaaggccaaggtgttt
gagcatgtgggcaagaccacacctgtcgccattcgcttctccaccgtggctggggaatcg
ggctcagcggacacagtgagagacccacgtggctttgcagtcaagttctacactgacgag
ggcaactgggaccttactggcaacaacacccccatattctttatcagggatgcaatgctg
ttcccatccttcatccactctcagaagcgcaacccccagactcacctgaaggacccagac
atggtgtgggacttctggagcctgcggcctgagtgtatgcatcaggtgtccttcctgttc
agtgaccgtggtctgcccgacggcttccgccacatgaatggctacggatcccacaccttc
aagctggtgaacgccgacagtcagcccgtctactgcaagttccactacaagaccaaccag
ggtatcaagaacatgaaacctgaggacgccgagcgcctggcctccaccgacccggactat
gccattcgagacctttacacctccatcgccaacggcaaattcccttcctggtcattctac
atccaggtcatgacctttgaccaggccgagaagttccagtggaacccctttgacctgacc
aaggtgtggtctcacaaggagtaccctcttattccggtggggaggttggtgctcaacaga
aaccctgccaactactttgctgagatcgagcaactggcctttgaccccagcaatatgccc
cctggcatcgagcccagccccgacaagatgctgcaggggcgtctgttctcctacccagac
acacaccgccaccggctgggaaccaactacctgcagctgcccgtcaactgccccttcagg
acccgtgtggccaactaccagcgagacgggcccatgtgcatgttcgacaaccaggctggc
gctcccaactacttccccaacagcttcagtgctccagagacccagcaacagcacgtggag
accaggtttaaggtatccccagatgtgggccgctacaacagcgctgacgacgatgatgtc
acacaggtgcgtaccttcttcactgaggtgctgaatgaggaggagcgccagaggctctgt
cagaacatggctggggccctgaaaggggcccaagtcttcatccagaaacgctggattcag
aacctgatggctgtgcatgcagactatggaaacggggttcaggccctactcaacaacact
gagcccacgaaggacactgtgagagtgtacactcgtggcggtgcctctgccgtcgctgcc
tcctccaagatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265579
Entry
112265579         CDS       T05605                                 

Definition
(RefSeq) catalase-like
  KO
K03781  catalase [EC:1.11.1.6]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00380  Tryptophan metabolism
otw00630  Glyoxylate and dicarboxylate metabolism
otw01100  Metabolic pathways
otw01200  Carbon metabolism
otw04068  FoxO signaling pathway
otw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    112265579
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    112265579
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112265579
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112265579
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     112265579
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 112265579
NCBI-ProteinID: XP_024298772
LinkDB
Position
2
AA seq 524 aa
MDEDRGKATDQLKLWKEGRSAQRPDNLTTGAGHPIGDKLNIITAGPRGPLLVQDTPFIDE
MAHFDRERIPERVVHAKGGGAFGYFEVTHDISRYCKAKVFEHVGKTTPIAIRFSTVAGES
GSADTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDAMLFPSFVHSQKRNPQTHLKDPD
MVWDFWSLRPECMHQVSFLFSDRGLPDGFRHMNGYGSHTFKLVNAERQPVYCKFHYKTNQ
GIKNLKPEDAERMASTDPDYAIRDLYTSIANGKFPSWSFYIQVMTFDQAEKFQWNPFDLT
KVWSHKEYPLIPVGRLVLNRNPANYFAEIEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPD
THRHRLGTNYLQLPVNCPFRTRVSNYQRDGPMCMFDNQAGAPNYFPNSFSAPETQRQHVE
TRFKVSPDVGRYNSADDDNVTQVRTFFTEVLNEEERQRLCQNMAGALKGAQVFIQKRWVQ
NLMAVHADYGNRVQTLLKNTEPTKDTVRVYTRGGASTITASSKM
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggacgaggatagagggaaagcaaccgaccaactgaaactatggaaagagggccgaagc
gctcagaggccagacaacctgaccactggtgctggtcacccgataggggacaagttgaat
ataataacagcgggtccccgggggcccctcctagtgcaggacaccccgttcatagacgag
atggcccactttgaccgcgagcgcatcccagagagggtggtacatgccaagggaggcgga
gcttttgggtactttgaggtgacacatgacatctctcgctactgcaaggccaaggtgttt
gagcatgtgggcaagaccacacctattgccattcgcttttccaccgtggctggggaatca
ggctcagctgacacagtgcgagacccacgtggctttgcagtcaagttctacactgacgag
ggcaactgggaccttactggcaacaacacccccatcttctttatcagggacgccatgctg
ttcccatccttcgtccactctcagaagcgcaacccccagactcacctgaaggacccagac
atggtgtgggatttctggagcctgcggcctgagtgtatgcatcaggtgtccttcctcttc
agtgaccgtggtctgcccgacggcttccgccacatgaatggctacggatcccacaccttc
aagctggtcaacgccgagcgtcagcccgtctactgcaagttccactacaagaccaaccag
ggtatcaagaacttgaagcctgaggatgccgagcgcatggcctccaccgacccggactac
gccatccgagacctttacacctccatcgccaacggcaaattcccctcctggtcattctac
atccaggtcatgacctttgaccaggctgagaagttccagtggaacccctttgacctgacc
aaggtgtggtctcacaaggagtaccccctcattcccgtggggaggttggtgctcaacaga
aaccctgccaactactttgctgagatcgagcagctggcctttgaccccagcaatatgccc
cctggcatcgagcccagccctgacaagatgctgcaggggcgtctgttctcctacccagac
acacaccgccaccggctgggaaccaactacctgcagctgcccgtcaactgccccttcagg
acccgtgtgtccaactaccagcgagacgggcctatgtgcatgttcgacaaccaggctggc
gctcccaactacttccccaacagcttcagtgctccagagacccagcgacagcacgtggaa
accaggtttaaggtgtccccagatgtgggccgctacaacagcgctgacgatgataatgtc
acacaggtgcgtaccttcttcaccgaggtgctgaatgaggaggagcgccagaggctctgt
cagaacatggctggtgccctgaagggagcccaagtcttcatccagaaacgctgggttcag
aatctgatggctgtgcatgcagactatgggaacagggttcagaccctactcaaaaacact
gagcccacaaaggacactgtgagagtgtacacccgtggaggtgcctctaccatcactgcc
tcctccaagatgtga

DBGET integrated database retrieval system