KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218557
Entry
112218557         CDS       T05605                                 

Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218557
   04068 FoxO signaling pathway
    112218557
   04150 mTOR signaling pathway
    112218557
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218557
   04140 Autophagy - animal
    112218557
  09143 Cell growth and death
   04114 Oocyte meiosis
    112218557
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218557
   04520 Adherens junction
    112218557
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112218557
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112218557
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112218557
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112218557
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   112218557
CD molecules [BR:otw04090]
 Proteins
  112218557
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase fn3 Furin-like Insulin_TMD Kinase-like TMEM154
Other DBs
NCBI-GeneID: 112218557
NCBI-ProteinID: XP_024235210
LinkDB
Position
19
AA seq 1413 aa
MRSGTERNNSTLFWGLMLSVSAICLLSANGKICGLSIDIRNDISEFKSLENCTVVEGYLQ
ILLIGEKTNNLNQELFRSLSFPKLTVITDYLLLFRVSGLDSLSTLFPNLNVIRGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNFIAGNKQ
SKECGDVCPGIMEDNAQCIKTSFNGNFNSRCWTSNHCQKVCPEKKCERRACTDSGECCHA
QCLGSCTEPDDDMACAPACTTTTRAAACSTAPQTLTSLRAGAASPWTCVPACHCPATLIC
HSRRRGMPECPSGFTRNESNSMFCSACDGLCDKICDSKTIDSVDAAQSLMGCTVIKGNLH
INIRRGNNIASELESFMGLIQTVTGYVRIRHSHTLGSLSFLKSLRYINGEELMEGMYAFS
AIDNQRLQYLWDWTQHNLTIRAGRLSFRFNPKLCMSEIHKMWEKTGITEKFEEDDFRNNG
DRASCESHILKFKSNSTVSNRIKLTWERYRPPDYRDLISFIVYYKEAPHQNITEFDGQDG
CGSNSWNMVDVDLPQDKEIDPGVLLSPLKPWTQYAIFVKAITLVVEDKHIPGAKSDVVYI
RTRPSEPSMPMDARAYANSSSKLVVKWSPPLNPNGNLTFYLVRWQQQAEDRELYQHNYCS
KELKIPIRISATGLADMEEDTKPTKSDLSGGDKGPCCPCPKTKEDLKAEIDDASYRKVFE
NFLHNSIFTPRPPDRRRRDLFGVANSTLARGGNTTGLEGNRTEGEPPEREFPFMEDRSKT
EFIEIPNLQPFTVYRIDIHACNQEVRRCSAGAFVFSRTKPADKADDMPGSVIQERDEKVE
GSVLLRWPEPVNPNGLILMYEIKFRQGTEPEKHECVSRQHYRVHKGTRLTNLGYGNYSAR
VRATSLAGNGSWTEPVSFYVPPPKRDYDNAFYLVIIIPIIVIILIASLITVLFFINKKRN
SDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMHKELGQGSFGMVYEGLAKGVVK
DEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMT
RGDLKSHLRSLRKENTSSQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAE
DFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEI
ATLSEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIINS
LKEELEPPFSEMSFFFSKENKPPDTEELDMEVENMENVPLDPAPSRPPTAAPQPSQGPMG
ATRGSAPPPPQQLSPIQGPSSTLMGPGSPSTSVPAASASASPSLALDKHSAQVSANGPVV
VLRPNFEDTQNYAHMNGGRKNERALPLPQSSAC
NT seq 4242 nt   +upstreamnt  +downstreamnt
atgagatctgggacagagaggaataattcgaccttgttttggggtctgatgctgtctgtc
tccgctatctgcctgttgtccgcaaatggaaaaatctgtggtctaagtatcgacatccgt
aatgacatcagtgagttcaagagtctggagaactgcacggtggtggagggctacctgcag
atcctcctcatcggagaaaagaccaacaacctcaaccaggagctcttccgctccctcagc
ttccccaagctgaccgtcatcaccgactacctgctcctgttccgcgtgtccggcctggac
agcctcagcacgctcttccccaacctcaacgtcatccgcggacgcaacctcttctacaac
tatgccctggtgatcttcgagatgaccagtctgaaggacattggcctgtacaacctgagg
aacatcacacgaggggccatccggatcgagaagaaccctgagctctgctacctggactct
gtggactggtctctcatcatggacgcagagttcaacaacttcatcgcggggaacaagcag
tccaaggagtgtggtgatgtgtgtccaggcatcatggaggacaacgctcagtgcatcaag
accagctttaacggcaactttaactctcgctgctggacatccaaccactgccagaaagtc
tgcccagagaagaagtgtgagcggagggcatgtacggacagtggtgaatgttgccatgcc
cagtgcctggggagctgtacggagccggacgacgacatggcctgcgcgcctgcctgcact
actaccacgagggccgctgcgtgcagcactgccccccagacacttacaagtttgagggct
ggcgctgcatcaccatggacctgtgtgcccgcgtgccactgcccagcgactttgatttgt
cattcacgaaggagaggcatgcctgagtgtccatcaggctttacacgcaatgagagcaat
agtatgttctgcagtgcctgtgatggcctgtgtgataagatctgtgactccaagaccatc
gactcagtggatgctgctcagtctctaatgggctgtacagtcatcaaaggcaacctgcac
atcaacatccgccgtggcaataacatcgcttcagagctggaaagcttcatggggctgatc
cagacagtgacaggctatgtgaggatccgccactcccacacgctaggctcgctctccttc
ctcaagagcctgcgctacatcaacggggaggagctcatggaagggatgtatgctttctct
gccatcgacaaccagcgcctgcagtacctgtgggactggacccaacacaacctgaccatc
agggctgggaggctgtcgttccgcttcaaccccaaactctgcatgtctgagatacacaag
atgtgggagaagacgggaatcactgagaagtttgaggaggacgatttccgcaacaatggg
gacagagccagctgtgagagccacatcctgaagttcaagtccaacagcacggtgagtaac
cggatcaagctgacctgggagcgctacagaccaccagactacagagacctcatcagcttc
attgtctactacaaggaggcaccgcaccagaatatcacagagtttgatggccaggatggg
tgtggctccaacagttggaacatggttgacgtggacctgcctcaggacaaagagatagac
cctggtgtgttgctgtccccactgaagccctggacccagtacgccatctttgtcaaggcc
atcacccttgtggtggaggacaaacacatcccgggagccaagagtgacgtggtctatata
cgcaccagaccctcagagccgtctatgccaatggatgcccgtgcgtatgccaactcatcc
tcaaagctggtagtgaaatggtcacctcccctcaaccctaacggcaatctcactttttac
ctggtccgctggcagcagcaagctgaagacagggagttgtaccaacacaactactgctcc
aaagagctgaagatccccatcaggatatcagccacggggttggcagacatggaggaggac
accaagcccaccaagtctgacctgtctgggggggataagggcccttgctgcccctgcccc
aagaccaaggaggacctgaaggcagagatagacgacgcctcctaccgcaaagtctttgag
aacttcctgcacaattctatcttcacccccagacccccagaccggcgacgtagggatcta
tttggtgtcgctaacagcaccctggcacggggtggcaacaccacaggcctggagggtaat
aggacagaaggagagccccctgagagggagttccccttcatggaggaccggagcaagaca
gagtttatcgagatccccaacctgcagcccttcactgtgtaccgcatcgacatccacgcc
tgtaaccaggaggtccgtcgctgcagcgctggagccttcgtcttctccaggaccaaacct
gcagacaaagcagatgacatgccaggcagcgtgatccaggagagggatgagaaggtggag
gggtcggtgctgctgaggtggccagagcctgtcaaccccaatggcctcatcctgatgtat
gagatcaagttccgccagggcaccgagcctgagaaacacgagtgtgtgtcacgccagcac
taccgtgttcacaaaggaactcgtctgaccaacctgggctatgggaactactctgcccgc
gtgcgtgccacctccctggcaggaaatgggtcctggactgagccagtgtccttctacgtg
cccccacccaaacgggactatgacaacgcattctatctggtcatcatcatccccatcatc
gtgataattctcatcgccagcctcatcactgtactcttctttatcaacaaaaagaggaac
agtgacaggctggggaatggtgtcctctatgcttctgtcaaccctgagtacttcagtgct
gccgagatgtatgttccagatgagtgggaggtggccagggagaaaatcaccatgcacaag
gagttgggccagggttccttcggcatggtgtatgagggcctggctaagggcgtggttaag
gacgagcctgagacccgcgtggccatcaagacagtcaacgagtcagccagcatgagggag
aggatcgagttcctcaatgaggcctctgtcatgaaggagttcaactgtcaccacgtggtg
cgtctgctgggcgtggtctctcagggccagcccaccttggtgataatggagctgatgacc
cgtggagacctgaagagccacctgcgatcactccggaaagagaacacgtccagccaggtt
ctgcccccgctgaagaagatgatccagatggcaggagagattgcggacggcatggcatac
ctcaacgccaacaagtttgtccacagagacctggctgccaggaactgcatggtggcggag
gacttcaccgtcaagatcggagactttggcatgacgcgagacatctacgagacggattac
tatcggaaaggaggaaaaggccttctgccggtccgctggatgtctccagagtcgctgaaa
gatggcgtgttcaccacaaattctgatgtctggtcgtttggggtggtgttatgggagatt
gccaccttgtctgagcagccgtaccagggcatgtccaacgagcaggtgctgcgtttcgtc
atggagggaggactcctggacaagcctgacaactgccctgacatgctgtttgaactgatg
cggatgtgctggcagtacaaccccaagatgcgtccctccttcctggagatcatcaacagc
ctcaaggaggagctggagcctccattcagtgagatgagtttcttcttcagcaaggagaac
aagcccccggacactgaggagctggacatggaggtggagaacatggagaatgtgccactg
gaccctgcacccagcagaccccccactgccgcccctcagccctcccagggacctatgggg
gccacacggggctcagcgccccctcctccccagcagttatctccaatacaaggcccttct
agtaccctgatgggacctggctccccctccacctcagtccctgctgcctctgcctcagcc
tcgccaagcctggctttggacaagcattcagcacaggtatcggccaacgggccagtggta
gtgctacggcccaactttgaggacacgcagaactacgctcacatgaacggggggcgcaag
aacgagcgggcgctgccactgccccagtcttcagcctgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252377
Entry
112252377         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252377
   04068 FoxO signaling pathway
    112252377
   04150 mTOR signaling pathway
    112252377
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252377
   04140 Autophagy - animal
    112252377
  09143 Cell growth and death
   04114 Oocyte meiosis
    112252377
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252377
   04520 Adherens junction
    112252377
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112252377
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252377
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112252377
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112252377
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   112252377
CD molecules [BR:otw04090]
 Proteins
  112252377
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Insulin_TMD Kinase-like
Other DBs
NCBI-GeneID: 112252377
NCBI-ProteinID: XP_024279300
LinkDB
Position
6
AA seq 1416 aa
MRSGTERNTLTLFWGLTLSVSTIYLWTANGEICGPSIDIRNDISEFKRLENCTVVEGFLQ
ILLIGDKTNNLNQELFRSLSFPKLTVITDYLLLFRVSGLDSLSTLFPNLNVIHGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNFIAGNKQ
SKECGDVCPGITEDNAQCIKTSFNGNFNSRCWTSNHCQKVCPEKKCERRACTDGGECCHA
QCLGSCTEPDDDMACAACLHYYHEGRCVQDCPPDTYKFEGWRCITMDLCARVHLPSDFDF
VIHEGECMPECPSGFTRNESNNHSMFCSACDGLCDKICDSKTIDSVDAAQSLMGCTVIKG
NLQINIRRGNNIASELESFMGLIQTVTGYVRIRHSHTLGSLSFLKSLRYINGEELMEGMY
AFSAIDNQRLQYLWDWTQHNLTIRAGRLSFRFNPKLCMSEIHNMWEKTDITEKFEEGDFR
NNGDRASCESHILKFKSNSTMSNRIKLTWERYRPPDYRDLISFIVYYKEAPHQNITEFDG
QDGCGSNSWNMVDVDLPQDKEIDPGVLLSPLKPWTQYAIFVKAITLVVEDKHIPGAKSDV
VYIRTSPSEPSMPMDTRAYSNSSSKLVVKWSPPLNPNGNLTFYLIRWQQQAEDKELYQHN
YCSKELKIPIRISATGLAEMEDDTKPTKPDLSGGDKGPCCPCPKTKEDLKAEIDDASYRK
VFENFLHNSIFTPRPPDRRRRDLFGVANSTLARGGNTTGLEGNGTDGESPEREFPFMEDR
SKTEFIEIPNLQPFTVYRIDIHACNQEVRRCSAGAFVFSRTKPADKADDMPGTVNQERDS
KVEGSVLLRWPEPVNPNGLILMYEIKFRQGTEPEKHECVSRQHYRVHKGARLTNLGSGNY
SARVRATSLAGNGSWTEPVSFYVTPRTRDYDITFYLVIIIPIIVIILIASLITALFFINK
KRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMHKELGQGSFGMVYEGLAKG
VVKDDPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSHLRSLRKENTSSQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCM
VAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVL
WEISTLSEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI
INSLKEELEPPFSEMSFFFSEENKPPDTEELDMEVENMENVPLDPAPSRPPTAVPLPSQG
PMGATGGXAPPPPQQLSPMQCPSNTLKGPGSPSTSVPAASVSASPGLALDKHSGQISANG
PVVVLRPNFEDTQNYAHMNGGRKNERALPLPQSSAC
NT seq 4251 nt   +upstreamnt  +downstreamnt
atgagatctgggacagagaggaatactttgaccttgttttggggtctgacgctatctgtc
tccactatctacctatggacggcaaatggagaaatctgtggtccaagtattgacatacgt
aatgacatcagtgagttcaagcgtctggagaactgcacggtggtggagggcttcctgcag
atactcctcatcggagacaagaccaacaacctcaaccaggagctcttccgctccctcagc
ttccccaagctgaccgtcatcaccgactacctgctcctgttccgggtctccggcctggac
agcctcagcacgctcttccccaacctcaacgtcattcacggacgcaacctcttctacaac
tatgccctggttatctttgagatgaccagtctgaaggacatcggcttgtacaacctgagg
aacatcacgcgaggggccatccggatcgagaagaacccggagctctgctacctggactct
gtggactggtctctcatcatggacgcagagttcaacaacttcattgcggggaacaagcaa
tccaaggagtgtggtgatgtgtgtccaggcatcacggaggacaacgctcagtgcatcaag
accagctttaacggcaactttaactctcgctgctggacatccaaccactgccagaaagtg
tgcccagagaagaagtgtgagcggcgggcatgtacggacggtggtgagtgttgccatgcc
cagtgcctgggaagctgtacggagccggacgacgacatggcctgcgcagcctgcctgcac
tactaccacgagggccgctgcgtgcaggactgccccccagacacttacaagtttgagggc
tggcgctgcatcaccatggacctgtgtgcccgcgtgcacctgcccagcgactttgacttt
gtcattcacgaaggagagtgcatgcctgagtgtccatcaggcttcacacgcaatgagagc
aataatcacagtatgttctgcagtgcctgtgatggcttgtgtgataagatctgcgactcc
aagaccatcgactccgtggatgctgctcagtctctaatgggctgcacagtcatcaaaggc
aacctgcaaatcaacatccgccgtggcaataacattgcctcagagctggagagcttcatg
gggctgatccagacagtgacaggctatgtgaggatccgacattcccacacactaggatcg
ctctccttcctcaagagcctgcgctacatcaacggggaggagctcatggaagggatgtat
gctttttctgccattgacaaccagcgcctgcagtacctgtgggactggacccaacacaac
ctgaccatcagggctgggaggctgtccttccgcttcaaccccaaactctgcatgtctgag
atccacaatatgtgggagaagacggacatcactgagaagtttgaggagggcgatttccgc
aacaatggagacagagcaagctgtgagagtcatatcctgaagttcaaatccaacagcacg
atgagtaaccggatcaagctgacttgggagcgctaccgaccaccagactacagagacctc
atcagcttcatcgtctactacaaggaagcacctcaccagaacatcacagagtttgatggc
caggatgggtgtggctccaacagttggaacatggttgacgtggacctaccgcaagacaaa
gagatagaccctggtgtgctgctgtccccactgaagccctggacccagtacgccatcttt
gtcaaggccatcaccctggtggtggaggacaaacacatccctggagccaagagtgacgtg
gtctatatacgcaccagcccctcggagccatctatgccaatggatacccgggcgtattcc
aactcgtcctccaagctggtggtgaaatggtcacctcccctcaaccctaacggcaatctc
actttttacctgatccgctggcagcagcaagctgaagacaaggagctgtaccaacacaac
tactgctccaaagagctgaagatccccattagaatctcagccacggggttggcagagatg
gaggacgacaccaagcccaccaagcctgacctgtctgggggggacaagggcccctgctgc
ccctgccccaagaccaaggaggacctgaaagcagagatagatgacgcatcctaccgcaaa
gtctttgagaacttcctgcacaactccatcttcacccccaggcccccagaccggcggcgt
agggatctatttggggtggctaacagcaccttggcgcggggtggcaacaccacaggcctg
gagggtaatgggacagacggagaatcccccgagagggagttccccttcatggaggaccgg
agcaagacagagtttatagagatccccaacctacagcccttcactgtttaccgcatcgac
atccacgcctgtaaccaggaggtccgtcgctgcagcgctggagccttcgtcttctccagg
accaaacctgcagacaaagcggatgacatgccaggcacggtgaatcaggagagggattcg
aaggtggaggggtcggtgctgctgaggtggccggagcctgtcaaccccaacggtctcatc
ctaatgtatgagattaagtttcgccaaggcactgagcctgagaaacatgagtgtgtgtca
cgccagcactacagagtgcacaaaggagctcgtctgaccaacctaggctctgggaactac
tctgcccgcgtgcgcgccacctccctggcaggaaatgggtcctggactgagccagtgtcc
ttctacgtaaccccacgcacacgggactacgacatcacgttctatctggtcatcatcatc
cccatcatagtgataattcttatcgccagcctcattactgcactcttttttatcaacaaa
aaaaggaacagtgacaggctgggtaatggtgtcctctatgcttctgtcaaccctgagtac
ttcagtgctgctgagatgtatgttccagatgagtgggaggtggccagggaaaagatcacc
atgcacaaggagttgggccagggttcctttggcatggtgtacgagggcctcgctaagggc
gtggttaaagacgacccagagacgcgcgtggccatcaagacggtcaacgagtcagccagc
atgagggagaggatagagttcctcaatgaggcttccgtcatgaaggagttcaactgtcac
cacgtggtgcgtctgctgggagtggtctctcagggacagcccaccttggtgataatggag
ctgatgacccgtggagacctgaagagtcacctgcgctcgctccgtaaagagaacacgtcc
agccaggttctgcccccgctgaagaagatgatccagatggcaggggagattgcggacggc
atggcatacctcaacgccaacaagttcgtccacagagacctggctgccaggaactgcatg
gtggcggaggacttcaccgtcaagatcggggactttggcatgacgcgagacatctacgag
acggattactatcggaaaggagggaagggccttctgccagtccgctggatgtccccagag
tcgctgaaagacggagtgttcaccacaaactctgatgtctggtcatttggggtggtgctg
tgggagatttctaccttgtctgagcagccgtatcagggcatgtccaacgagcaggtgctg
cgtttcgtcatggagggaggactcctggacaagcctgacaactgtcctgacatgctgttt
gagctgatgcggatgtgctggcagtacaaccccaagatgcgtccttccttcctggagata
atcaacagcctcaaggaggagctggagcctccgttcagtgagatgagcttcttcttcagc
gaggagaacaagcccccggacactgaggagctggacatggaggtggagaacatggagaac
gtgccactggaccctgcacccagcagaccccccactgctgttcctctaccctcccaggga
cccatgggggccacagggggctragcaccccctcctccccagcagttatccccaatgcaa
tgcccttctaataccctgaagggacctggctctccctccacctcagtcccggctgcctct
gtctcggcctccccaggcctggccttggacaagcactcaggacagatatcggccaacggg
ccagtggtggtgctgcggcccaactttgaggacacacagaactacgctcacatgaacggg
gggcgcaagaatgagcgggcgctgccactgccccagtcttcagcctgctga

DBGET integrated database retrieval system