KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218574
Entry
112218574         CDS       T05605                                 

Definition
(RefSeq) talin-2-like
  KO
K06271  talin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112218574
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112218574
  Exosomal proteins of other cancer cells
   112218574
SSDB
Motif
Pfam: I_LWEQ VBS Talin_middle FERM_f0 FERM_M FERM_N IRS
Other DBs
NCBI-GeneID: 112218574
NCBI-ProteinID: XP_024235236
LinkDB
Position
19
AA seq 2547 aa
MVALSLKICVRQCNVVKTMQFEPCTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRK
GIWLESGRTLDYYMLRNGDVLEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEAVEEKKEDGHGTGTLKKDRTLLRDERKMERLKAKLHTDDDLNWLDH
SRTFREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKAC
EFAGIQAQIQFGLHVEHKHKTGFLDLKEFLPKEYIKQRGSEKKIFVDHKTCGEMTEIESK
VNYVKLARSLPTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVEEKTKDVVQEWPLTT
VKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDCFGVEGDD
ESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGIIRSGSIGGPDNTFNMGTMPSAQQ
QITTGQMHRGHMPPLSLAQQALMGTINTSMQAVQQAQADLGEVDNLPPLGQDMASRVWVQ
NKVDESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSRGVKL
LAALVEDQVGSGQNLMGAARTLTGAVSDLLRSVEPAAGEPRQTVLTAAGSIGQAGGDLLH
HMGEGETDERFQDILMSLAKAVANAAAMMVLKAKNVAQVAEDTVLQNRVIAAATRCALST
SQLVACTKVVSPTISSPVCQEQLVEAGKLVDRSVESCVKACLSATDDSEHLKQVGAAANT
VSQALSDLLQHVRHYASCGEPIGRYDQATDTIMTVTESIFTSMGDAGEMVRQARVLAQAT
SDLVNAMRSDAEAEVDVDNSKKLLAAAKLLADATARMVDAAKGAAAYPENEDQQQRLREA
AEGLRVATNAAAQNAIKKKLVNRLEIAAKQAAAAATQTIAAAQNAAVSNKNTASHQQLGH
SCKAVADHIPQLVQGMRSSQAQPEELSAQLALIMASQSFLQPGSKMVTSAKSTVPTVTDQ
AAAMQLGQCAKNLATCLAELRTATQKAHEACGPLEIDSALSAVQTLRSELQDARMAAHDG
QLKPLPGESLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHFTGVAARETAQALRTLAQA
ARGVAASTKEPQSAAAMLDSAQYVMEGSAMLIHEAHQALVSPGDAESQQRLAQVAKAVSH
SLNNCVNCLPGQKDVDMALRSIGEASKKLLVDTLPPCSKSFQDAQSELNHTAAELNHSAG
DVVHSSRGTSSQLAVASGKFSEDFDEFLDAGIEMAGHTQSQEDQITVIGNLKNISMASSK
LLLAAKSLSVDPGAANAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELEAVR
GLLDNPSEPVSELSYFDCIESVMENSKVLGESMAGISQHCKTGNVPAFGDCVGVASKALC
GLTEAAGQASYLVGVSDPNSQSGQEGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSA
ATIVAKHTSALCNACRLASSKTSNPVARRHFVQSAKEVANTTANLVKTIKALDGDFSEEN
RNRCHVATTPLIEAVENLSTFSSNPEFASIPAQISNEGSAAQEPIMRSACSMLDSSTLLL
ETARSLIINPKDPPTWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDFSIDNINKCVRD
IEQASLAAVGQSLQGCRDDISLEALQEQLTSSVQEIGHLIDPINTAARGEAAQLGHKVTQ
LASYFEPLIVASVGLASKIVDQQQQMNILDQTKTLSESALQMLYAAKEGGGNPKAAHTHD
AISEAAQLMKEAVDDIMVTLNEAASEGGMVGGMVEAIAEAMGRLDEGTPPEPEGSFVDYQ
TTMVKYSKAIAITTQEMMTKSVTCPEELGGLASQVTVDYSQLAHQGHMAAATAEPKEVGF
QIKTRVQELGHGCIYLVQKAGALQMSPTDSFSKRELIECARAVTEKVAMVLSALQAGNKG
TQACITAASALSGIIADLDTTIMFASAGTLNPENEETFADHRESILKTAKALVEDTKLLV
SGAASSQDRLAQAAQSSVKTITMLTDVVKLGATSMGSDDPETQVVLINAVRDVAKALAEL
ISATKCASGKPADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIK
QELTVFQSKDVPEKSTTPEEFMRMTKGITMATAKAVAAGNSAQQEHVIATANLSRKAISD
MLTTCKQAACHPEVSEEVRNKALLYGSECTTGYIHLLEQVLLVLQKPTADQRQQLAVHSK
CVAGCVTELIQTAEAMKGSEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQ
ADETLDFEEQILEAAKSIAAATSALVKSASVAQRELVAQGKVGSILANAVDDGQWSQGLV
SAARMVAAATSNLCEAANASVQGHSSEEKLISSAKQVAASTAQLLVACKVKAQPDSEAMR
RLQAAGNAVKRASDNLVKAAQKAAFHKADDHSVVVKTKFVGGIAQIIAAQEEMLRKEREL
EEARKKLAQIRQQQYKFLPTELREDQS
NT seq 7644 nt   +upstreamnt  +downstreamnt
atggtggccctttcactgaagatctgtgtccgccagtgcaatgtggtgaagaccatgcag
tttgagccctgcactcctgtgtatgatgcctgtaggatcatcagggagagggttccggaa
gcccagactggccaagcctctgattacggcctgtttctctctgatgatgatcccagaaaa
ggaatctggctggagtctgggagaactctggattactacatgctccggaacggggatgtc
ttggagtacaaaaagaaacagaggccccagaagatcaagatgctggatggggcagttaaa
actatcatggtggatgactctaaaactgtgggagagctgcttgtaaccatatgcagtaga
ataggaatcaccaactacgaggagtactccctgatccaggaggcggtggaggagaagaag
gaggacggtcatgggactggcaccctgaagaaggacaggactctgctccgagacgagagg
aagatggagaggctcaaagccaagcttcacacagacgatgacttgaactggctggaccac
agccggacgttcagagagcaaggggtggaggagagcgagatgctgctgctcagacgcaag
ttcttctactcagatcagaatgtggactcacgagaccctgtccagctcaacctcctctat
gtacaggccagagatgacatactgaatggctcccaccctgtttcatttgataaagcctgt
gagttcgctggaattcaggcccagatccaatttggcctccacgttgaacacaaacacaag
actggattcctagaccttaaggagtttctacccaaagagtacatcaagcagagaggttca
gagaagaaaatatttgtggatcacaaaacctgtggagaaatgacagagattgagtccaaa
gtaaattatgtgaaactagcgaggtcccttccgacatatggggtctccttcttcctggtg
aaggaaaagatgaaaagcaagaataagctggtcccacggttactggggataaccaaagag
tcggtgatgcgggtggaagagaagactaaagacgtggttcaggaatggcccctaaccacg
gtgaagagatgggctgcttctccaaagagcttcaccctggattttggggagtaccaggaa
agttactactctgttcagaccacagagggggaacagatctctcagctgattgcaggatac
atcgacatcattctcaaaaagaagcagagtaaggattgttttggtgtggaaggagatgac
gagtccaccatgctggaggaatctgtctctccaaagaagtcgaccatcctgcagcagcag
tttaacagggtgggtcgtgtggagcatggctcggtggcactgccaggtatcatccgctcc
gggtccatcggtggccctgacaacaccttcaacatgggcaccatgccctctgcccagcag
cagatcaccacagggcagatgcacagaggacacatgcccccgctgagcttggcccagcag
gccctgatggggaccattaacaccagtatgcaggcagtgcagcaggcccaggctgatctg
ggggaggtagataacctgcctcctcttggacaggacatggcgtccagagtttgggttcaa
aacaaagtggatgagtccaaacatgaaatccactctcaagtagatgccataactgccgga
accgcatctgtggtcaatcttactgcaggtgaccctacagatacagactacacagcagtt
ggctgtgccatcaccaccatctcctccaacctgacagagatgtctaggggggtgaaactg
ctggcagcgctggtggaggaccaggtgggcagcgggcagaacctgatgggagctgccagg
accctgacaggggccgtctctgacctgctcaggtctgtggagcctgcagctggagagccc
agacagacggtgctgactgcagcaggaagtataggccaggccggcggagacctgctgcat
catatgggggagggcgagaccgacgagaggttccaggacattctaatgagcctggccaaa
gcggtggccaacgcagctgctatgatggtcctcaaggccaagaatgtggcccaggtggca
gaggacacagtgttgcagaaccgagtgattgcagctgctactcggtgtgccctttccacc
tcacagctggtggcctgcaccaaggtggtgagccccaccatcagttctccggtgtgccag
gagcagctggttgaggcagggaagctggtggaccgctcggtggagagctgcgtcaaggcc
tgcctgtctgcaacagacgacagtgagcacctgaagcaggtaggtgccgcggccaacact
gtgagccaggcactcagtgacctgctgcagcacgtacgccactatgccagctgtggtgag
cccatcggacgttacgaccaggccacagacaccatcatgaccgtcaccgagagcatcttc
acctccatgggagacgcaggggagatggtgcgtcaggccagggtgctggctcaggccact
tctgacctggtcaatgccatgaggtcagatgctgaggccgaggtggacgtggacaactca
aagaagctcctggctgcagccaaactcctggctgacgccacagccaggatggtagatgct
gctaagggagctgcagcttacccagagaatgaggaccagcagcagaggctgagagaggca
gcagaggggttacgtgttgccactaacgctgcagctcagaatgcaatcaagaagaagctg
gtcaacaggctggagattgctgctaagcaggctgcggctgctgctactcagaccatcgca
gctgcccagaatgctgctgtgtccaataagaacactgcctctcatcaacaactaggacac
agctgcaaggcagtggcagaccacatccctcagctggtccaggggatgaggagtagtcag
gctcagccagaggaactcagtgcccaactagccctgataatggccagccagagcttccta
cagcctggcagtaagatggtgacgtctgcaaagtcaactgtccccacagtgacggaccag
gctgcagcgatgcaacttggccaatgtgccaagaacctggctacctgccttgctgagcta
cggacagccacccaaaaggcccatgaagcctgtggtcctctggagatagactctgctctc
agtgctgtccaaactctcaggagtgagcttcaagatgccaggatggctgcgcacgatggg
cagctcaaaccacttcctggggaatcgctagagaagtgtgcccaggacctgggtagtacc
tccaaggctgttggctcctctatggcccagctgctgacctgtgctgcacagggcaatgag
cacttcacaggagtggctgccagggagactgcccaggccttgaggacactggcccaggca
gccagaggtgtcgctgccagcactaaggaaccccagtctgcggcggccatgttggattct
gcccagtacgttatggagggctctgccatgctcatccatgaggcccaccaggccctggtc
tcccccggcgacgcagagagtcagcaaaggctagcacaggtggccaaggcagtgtcccac
tctctgaataactgtgtgaactgcctgcctggccagaaggatgtggacatggccctaaga
agcatcggagaggccagtaagaagctgctggtggacactctccccccctgcagtaagtcc
ttccaggatgctcagagtgagctgaaccatactgctgcagagctcaaccactcagcagga
gatgtggtccattcctcccggggtaccagcagccaactggccgtggcttctgggaaattc
agtgaggactttgatgagttcctggacgccggcattgagatggctggacacactcaatcc
caagaggaccaaatcacagtgattggcaacctgaagaacatctccatggcatccagcaag
ctccttctggcagccaagtccctgtcagtggatcctggagcagctaacgccaagaacctg
ttagctgctgcagcaagagcggtgacagagagcattaatcagctcatcacactgtgtacc
cagcaggcaccgggccagaaggagtgtgacaacgctctgagagaactggaggctgtgaga
ggattgctggacaaccccagtgagcctgtcagtgagctctcctactttgactgcatcgag
agtgtcatggagaactcaaaggttcttggagagtccatggcggggatttctcagcactgt
aagacgggcaacgtgccagcgtttggcgattgtgtgggagtggcgtccaaggccctgtgt
gggttgacggaggcggctggacaggcctcctacctagtgggtgtgtccgatccaaacagc
caatctggtcaagagggtctggtggatccaatccagtttgcccgggccaaccaggctatt
cagatggcctgtcaaaacctggtggacccagccagcagcccctctcaggttctgtccgca
gcgacgattgtagccaagcatacctcagctctttgcaatgcctgccgcctggcctcrtcc
aagacatccaaccctgtggccaggagacactttgttcagtcagccaaagaggttgcaaac
accacggccaaccttgtgaaaactataaaggccttggatggggatttctcagaggagaac
agaaacaggtgccatgttgctacaactccacttatcgaggctgtagagaatctatccaca
ttttcctccaacccggagtttgctagtatccctgcacagatcagcaatgagggctctgca
gcccaggagcccatcatgcgttcagcctgctccatgctggacagctccaccctgctcctg
gagactgcccgctcgctcatcatcaaccccaaagacccgcccacctggtccatcctggct
gggcactcccgcaccgtctctgactccatcaagagcctcatcacctccatcagggacaag
gcaccagggcagagagagtgtgacttctccattgataacatcaacaagtgtgtccgggac
atcgagcaggcttctctagctgctgtgggccagagcctacagggatgtagggatgacata
tctttggaagctttgcaggagcagctgacatcgtcggtgcaggagattggacatctcatc
gatcctatcaatactgcagccaggggtgaagctgcccagctgggacacaaggtgacccag
ctggccagctactttgagcccctcatcgtggcgtctgttggcctggcctctaagatcgtg
gaccagcagcagcagatgaacatcctggaccagactaagaccctgtcagagtccgccctg
cagatgctttacgcagccaaggagggaggtggaaaccctaaggcggcccacacccacgac
gccatatcagaggctgcccagctgatgaaggaggctgtggacgacatcatggtgactctg
aacgaggcggccagtgagggcggcatggtgggaggcatggtggaggctatcgctgaggcc
atgggcaggttggatgagggcactccccctgaaccagaaggatcctttgtggattaccag
accaccatggtgaaatactccaaggccatcgccatcacaactcaggagatgatgactaag
tcggtgacatgtccagaggagctgggtggcctggcctcgcaggtgactgtagactacagc
cagttagcccaccaaggtcacatggcagctgccaccgcagaaccaaaagaggtgggcttc
cagatcaagacgcgggtccaggagctgggccatggatgtatctacctggttcagaaggct
ggagccctgcaaatgagccccactgacagcttctccaagagggagctcattgagtgtgcc
cgtgccgtcactgagaaggttgccatggtgctgtctgcactgcaggcaggtaacaaaggt
actcaggcctgcatcacagcagctagtgctctgtctggcatcatcgcggacctcgacacc
accatcatgttcgcctcggccggaacactcaaccctgagaacgaagagaccttcgctgac
cacagggagagcattctgaagacagccaaggctctggtggaggacactaagctgctggtg
tctggggcagcgtccagtcaggacagactggcccaggctgcccagtcctcagtcaagacc
atcaccatgctcactgacgtggtcaaactgggggccaccagcatgggctctgacgaccca
gagactcaggtggtcctcattaatgcggtgagagacgtggccaaggctctagctgagctc
atcagcgccaccaagtgtgcttcaggcaagccagctgatgacccgtccatgtatcagctg
aagagtgctgccaaggtgatggttaccaacgtgacgtccctgctgaagactgtgaaggct
gtggaggatgaggctactcgcgggacgagggcactggaggccaccattgagtgcatcaaa
caggagttgacagtgttccagtccaaggacgtccccgaaaagtcgaccacaccggaagag
ttcatgcgcatgacaaagggcatcaccatggcaacggccaaggctgtggcagcaggaaac
tctgcccagcaggagcacgtcatcgccacggccaacctgagccgcaaagccatctctgat
atgctgaccacctgcaagcaagcggcctgtcatccagaggtgagtgaggaggtgaggaat
aaggccctgctctacgggtcagagtgcaccactggatacatccacctgctggagcaagta
ctgctggtgctccagaagcccacagcggaccagaggcagcagctggcagtacactccaag
tgcgtggcggggtgtgtgacagagctcatccagacggctgaggccatgaaggggtcagaa
tgggtggaccctgaggaccccactgtcatcgctgagactgagctgctgggtgcggcagcc
tccatcgaagccgcagccaagaaactggagcagctgaaacccagagccaagcccaagcaa
gcagatgagacgctggactttgaggagcagatcctggaggcagctaaatccattgctgca
gccaccagtgccctggtgaagtctgcttctgtagcccagagagagttggtggcacagggc
aaggtaggatccattcttgccaatgctgtggatgatggccagtggtctcagggtctcgta
tctgctgctcggatggtggcggcagctactagtaacctgtgtgaggcggccaatgcctct
gtgcagggccactccagtgaggagaagctcatctcttcagccaagcaggtggcagcctcc
acagctcagctcctagtggcctgtaaggtcaaagctcaaccggactccgaggccatgagg
agactgcaggctgctgggaacgcggtcaagcgggcatcagacaacctggtgaaggcggct
cagaaagctgcctttcataaagctgatgaccacagtgtggtggtcaagaccaagttcgtg
ggtggcattgctcagatcattgcagcccaggaggagatgctgaggaaggagagagagctg
gaggaggccaggaagaagctagctcagatcagacagcagcagtacaagttcctgcccact
gagctaagggaggatcagagctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219996
Entry
112219996         CDS       T05605                                 

Definition
(RefSeq) talin-1-like
  KO
K06271  talin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112219996
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112219996
  Exosomal proteins of other cancer cells
   112219996
SSDB
Motif
Pfam: I_LWEQ Talin_middle VBS FERM_f0 FERM_M FERM_N ACBP IRS DUF1013 Myosin_TH1
Other DBs
NCBI-GeneID: 112219996
NCBI-ProteinID: XP_024237279
LinkDB
Position
20
AA seq 2543 aa
MVALSLKIGVGNVVKTMQFEPSTMVYDACRMIRERVPEAQLGQPNDYGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVHDMVEEKKEEMTGTLTRRDKTLMRDDKKMEKLKQKLHTDDELNWLDHGRT
LREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACDFA
GYQCQIQFGDHNETKHKPGFLDLKEFLPKEYIKNKGEKRIFQAHKNYQNMTEIEAKVSYV
KLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRW
AASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTM
LEDSVSPKKSTVLQQQFNKVGKVETGSVALPAIMRSGAGGPESFQMGSMPQAKQHITSGQ
MHRGHMPPLTSAQQALTGTINSSMQALQAAQASLEEFDTLPPLGTDAASQAWRKNKMDES
KHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME
DEGGNGNQLLGAAKNLACAVSDMLKTAQPANTEPRQNLLQAAGNVGQASGELLSHIGETD
ADPRFQDMLMQLAKAVANAAAALVLKAKNVAQKTEDSALQNRVIAAATQCALSTSQLVAC
TRVVAPTISSPVCQEQLIEAGKLVAKSVDGCVDASQGATSDEGLLKQVGAAATGVTHALN
ELLQHIKQYAHGGQPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSDLVNA
IKMDAEGESDLENSRKLLSAAKLLADATAKMVEAAKGAAANPDSEEQQQRLREAAEGLRM
ATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVA
DQIPQLVQGVRGSQSQPDSPSAQLTLIGAGQNFLLPGAKMVTAAKATVPTIGDQASAMQL
SQCAKNLATALAELRTAAQKAQEACGPLEIDNALTVVRGLEKDMVEAKASAGDGKLKPLP
GETLEKCSQDVGNSTKAVSSAIAQLLSEATQGNENYTGMAARDVAQALRALASAARGVAA
TTADPQARNAMLDCAGDVMDKSANLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSV
NCLPGQRDVDNAIRTVGEASKKLLANSFPPSGKSFQEAQVNLNQAAAGLNQSANELVQSS
RGTTQDLAKATGKFGHDFGEFLDAGVDMAGQSQNKENQTQVVSNLKTISMSSSKLLLAAK
VLSTDPNSPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRGLLENP
TEAVSDLSYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDSVSSGSKALCGLTEAA
AQGAYLVGVSDPKSHAGQKGLVDPGQFARANQSIQMACQNLVDPACTQSQVLSAATIVAK
HTSALCNACRLASSKTANPTAKRHFVQSAKEVANSTANLVKSIKALDGAFNQQNREKCRV
ATGPLIEAVDNLTAFASNPEFASVPAQISAEGLAAMEPIVVAAKTMLESSTGLIQTARSL
AVNPKDPPKWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIEVLNNCIREVDQASL
AAISQQLTPREDISQEALHEQLAASVQEISNLIEPVAIAARSEASHLGHKVSQMVSYFEP
LIMAAIGTASKIQSSQQQMAVLDQTKTLTESALQMLYTAKEAGGNPKAAHTQEALEESVQ
MMKEAVDDLGATLSETASAAGALGGMVDSITAAINKMEESPAGEPDGSFVDYQTTMVKTA
KAIAVTVQEMVTKSNTNPDDLGGLASELTNEFGELATEAKYAAITAENDEIGSHIKKQVG
ELGFNCTGLVTKAGALQCSPNDSFTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITA
ASTVSGIIADLDTTIMFATAGTLNRENSETFADHREHILKTAKALVEDTKLLVSGAGASQ
ERLAQAAQSSVITITKLADVVKLGAASLGAEDPETQVVLINAVKDVAKALSDLISATKAA
AGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRGLEATIEHIKQELAVFS
NGDPPPKTSTPEDFIRMTKGITQATAKAVAAGNSCRQEDVIATANLSRRAIADMLHSCKQ
AAYHPEVSKEVQNRALRYGNECALGYLGLLEHVLVPIIQKPSHELKQQLANYSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAARKLELLRPRTKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGACPANAVDDGQWSQGLISAARMV
AAATSNLCEAANSAVQGHASEEKLVSSAKQVSASTAQLLVACKVKADQDSQTMKRLQAAG
NAVKRASDSLVKAAQKAAFDAQDEQAVVVKSKMVGGIAQIIAAQEEMLRKERELDEARKK
LATIRQQQYKFLPSELREDGQEQ
NT seq 7632 nt   +upstreamnt  +downstreamnt
atggtggccctgtcactgaagattggcgtggggaacgtggtgaagaccatgcagtttgag
ccctccaccatggtgtacgacgcctgtcgaatgatcagggaaagagttcccgaggcacag
ctgggccagcccaatgactatggtctgttcctgtccgatgaggaccccaagaaaggcatc
tggctggaggcaggcaaggccctggactactacatgctgaggaatggggacactctggag
tacaagaagaagcagaggcccttgaagatccgcatgctggacgggacagtgaaaaccgtc
atggtggacgactccaagatcgtcagcgacatgcttatgaccatctgtgccaggataggt
atcacaaactatgacgagtactcgttggtgcacgacatggttgaggagaagaaggaggag
atgacggggactctgacaagacgggacaagactctgatgagagacgacaagaagatggag
aaacttaagcagaaactccacacagatgacgagttgaactggctggaccatgggcggacg
ctgagggagcagggtgtggaggagaccgagatgctgctcctcaggaggaagttcttctac
tcagaccagaacgtggactcacgagacccggtccagctcaacctgctctacgtccaggcc
cgtgatgacattttgaacggctcccatcccgtctccttcgagaaggcctgcgactttgct
gggtaccagtgtcagatccagtttggtgaccacaacgagaccaagcacaaaccaggcttt
ctagatttgaaagagttcctccctaaagagtacatcaagaacaaaggagagaaaagaatc
ttccaggcacacaaaaactaccaaaacatgactgaaatcgaggccaaagtcagctacgtc
aaactggctaggtctctgaaaacctacggagtgtccttcttcctagtaaaggagaaaatg
aagggtaagaacaagctggtccctcgtcttctgggaatcaccaaggagtgtgtcatgcgg
gtagacgagaagaccaaggaggtgatccaggagtggaacctcaccaacatcaaacgctgg
gctgcctcgcccaagagcttcaccctggactttggcgattatcaagacggttactactct
gtccagacgactgagggagagcagatcgcccaactgatcgctggttacattgacatcatt
ctgaaaaagaaaaagagcaaggaccactttggcttagagggagatgaggagtccaccatg
ttggaggattctgtgtcacccaaaaagtctacagtgctgcagcagcagttcaacaaggtg
gggaaggtggagactggctctgtggccctgccagccatcatgcgttcaggggccgggggc
cccgagagcttccagatgggctccatgcctcaggccaagcagcacatcaccagcggacag
atgcacaggggccacatgcccccgctgacatcagcccagcaggccctgactggcaccatc
aactccagcatgcaggcgttgcaggctgcccaggcctcgctggaggagtttgacaccctg
cctcccctcgggacagacgcggcctcccaagcctggcgtaagaacaagatggacgagtcc
aaacacgagatccactcccaggttgacgccatcacagccgggacggcctctatggtcaat
ctcaccgcaggcgacccagcagagacagactacacggcggtgggctgtgccgtgaccacc
atctcctccaacctaacggagatgtccaagggggtcaagctgctcgccgccctcatggag
gatgagggaggcaacggaaaccagttgttgggggctgccaagaacctggcgtgtgccgtg
tccgacatgctaaagaccgcccagccagccaacactgagccccgtcagaaccttctgcag
gctgcaggcaacgtgggccaggccagtggcgagctgctgtctcacatcggagagacggac
gccgacccccgctttcaggacatgcttatgcagctggctaaagccgtggctaacgccgcc
gccgctctggtgctcaaagcaaagaacgtggcccagaagacagaggactctgcactccag
aaccgcgtcatcgccgcggcgacccaatgtgccctatccacctcccaactggtggcttgc
acccgggtggtcgctcccaccatcagctctccggtgtgccaggagcagctgattgaggca
ggcaagctggttgccaaatcggtggatggctgcgtggatgcgtcgcagggcgccaccagc
gatgaggggctcctcaagcaggtgggcgccgccgccacaggcgtcacccatgccctcaac
gagctcctgcagcacatcaagcagtacgcccacggaggccagcccatagggcgccacgga
gaggccaccgaccgcatcctggatgtcaccgagaacatcttcagctccatgggagatgcc
ggtgagatggtgcgtcaggcccgcatccttgcccaggccacctcggacctggtcaacgcc
atcaagatggacgcagagggcgagtcagacctggagaattcccgcaagctgctgtcagcc
gccaagctcctggcagacgccacggccaaaatggtggaggctgccaagggcgcagccgcc
aacccggacagtgaggagcagcaacagagactgagggaggcagcagagggcctacgcatg
gccaccaacgcggctgcccagaatgccatcaagaagaggctggtcaacaagctggagaac
gcagccaagcaggccgccgcggccgccactcagactatagccgccgcccagcacgccgcc
tcgtccaataagaacccagcagcccagcagcagctcgtccagagctgcaaggtggtggca
gaccagatccctcagctggtccagggagtgcgtggaagccagtcccagcccgacagcccc
agtgcccagctcaccctcatcggggccggtcagaacttcctcctgcctggtgccaagatg
gtgacggctgccaaggccacagtacctaccattggcgaccaggcctctgccatgcaactc
agccagtgtgccaagaaccttgccactgcccttgccgagctccgcacggccgcacagaag
gcacaggaagcatgtggtcctctggagatcgacaatgctctgacggtggtccgaggcctg
gagaaagacatggtggaggccaaggcttcagctggcgatggcaaactcaaacccctgccc
ggagagacgctggagaagtgctctcaggacgtgggcaacagcactaaggctgtgagctct
gccatcgcccagctgctgagtgaggccacccagggcaatgagaactacacaggtatggca
gccagagacgtggctcaggcattgcgcgctctggcctcggccgcccgtggggttgccgcg
acgaccgccgaccctcaggcccgcaacgccatgctggactgcgctggtgacgttatggac
aagtcggccaatttgatcgaagaaaccaagagagccattgccaagccgggagatcctgac
agccagcagagactggcacaggtggccaaggctgtatcccaggccctgaacaggagtgtg
aactgcctgcctggacagagagatgtggacaacgctataagaacagtcggagaggccagt
aagaaactactggccaattctttcccacccagtgggaagagtttccaggaggcgcaggtc
aacctgaaccaggctgcagccggtctcaaccagtcagccaatgagctggtccagtcgtcc
aggggcaccacccaggacctggccaaggccactggcaagttcggccatgacttcggagag
ttcctggatgccggcgtggacatggccggccagtcacagaacaaggagaaccagacgcag
gtggtgtccaacctcaagaccatctccatgtcgtccagtaagctgctgcttgccgccaag
gtcctgtccaccgaccccaactcccccaacctcaagaaccaactagcagctgctgctcgt
gccgtcactgacagtatcaaccagctcatcaccatgtgtacccagcaggccccgggccag
aaggagtgtgacaatgctctccgggagctcgagactgttcggggactgcttgagaacccc
accgaggcggtcagtgacctctcctactttgactgcatcgacagtgtcatggagaactct
aaggtcctgggggaagccatggctggaatctcccacaacgctaagaacagcaatctgcct
gagtttggagactctgtcagctctggctctaaagccctgtgtggccttacggaagcagct
gcccagggtgcctacctggttggagtgtcagaccctaaaagccacgcgggccagaagggg
ttggtggaccctggccagtttgcccgtgccaaccagtccatccagatggcatgccagaac
ctggtggacccggcctgcacccagtcccaggtcctctctgccgccaccatcgtggccaag
cacacttcggcgctgtgcaatgcctgtcgcctggcctcctccaagacagccaaccccaca
gccaagagacactttgtccagtctgccaaggaggtggccaacagcacagccaatctggtc
aagtccatcaaagctctggatggagcgtttaaccagcagaacagagagaagtgtagggtc
gccacagggcccctgatagaagctgtggataacctcaccgccttcgcctccaacccagaa
ttcgccagcgtgcccgctcagatcagcgctgagggcctggcagcgatggagcccatcgtg
gttgcagctaagaccatgctggagagctccacaggtctgatccagaccgctcgctccctg
gccgtcaaccccaaagacccccccaagtggtcagtgctggccggacactccaggaccgtt
tccgactccatcaagaaacttatcaccaacatgagagacaaagccccaggccagagggag
tgtgacgaggccatcgaggtgctgaacaactgtattcgggaggttgaccaggcctccctg
gcagccatcagccagcagctcaccccaagagaggacatctcccaggaggctctgcatgag
cagctggcagcttcggtccaggagatcagcaatctgatagagccggtggccatcgcagct
cgctctgaggcttcccatctgggacacaaggtgtctcagatggtgagctatttcgagccc
ctcatcatggcagccatcggcacggccagtaagattcagagcagccaacagcagatggca
gtgttggaccagaccaagacgctgacagagtcagccctgcagatgctctacacagccaag
gaggccggaggaaaccccaaggcggcccacacccaggaggctctggaggagtctgtccag
atgatgaaggaggcggtagacgacttaggcgccaccctgtcggagacggccagcgctgcg
ggcgccctgggcggcatggtggactccatcaccgccgccataaacaagatggaggagagc
cctgccggcgagcccgatggctcctttgtggattaccagactaccatggtgaagactgcc
aaagccatcgccgtcaccgtgcaggagatggtgactaagtccaacaccaacccagatgac
ctgggaggtctggccagcgagcttactaatgagtttggagagctagccaccgaggccaaa
tacgctgccatcactgcagagaacgacgagattggttcccacatcaagaagcaggttggg
gagctcggcttcaactgtactgggctggtgactaaggccggagctctacagtgtagtccc
aacgactccttcaccaagaaggagctgatcgacagcgcacgcaaggtctccgagaaggtg
tctcatgtgctggcggcccttcaggctggtaaccgtggcacccaggcctgcatcacagca
gccagtaccgtgtcgggcatcatcgccgacctggacaccaccattatgttcgccaccgcc
ggcacgctcaaccgtgagaactcggaaaccttcgccgaccacagagagcacatcctaaag
acagccaaggcgctggtggaggacaccaagctgctggtctctggtgccggggccagccag
gagagactggcccaggctgcccagtcctccgtcatcaccatcaccaaactggccgacgtg
gtaaaactgggtgccgccagcctgggcgccgaggaccccgagacacaggtggtcctgatc
aacgctgtcaaagacgttgccaaggctctgagtgacctcatcagcgctaccaaggccgct
gcaggcaagcctcacgacgaccctgccatgctgcagctgaagaactctgccaaggtgatg
gtgaccaacgtgacgtcactcctgaagacagtgaaggcagtggaggacgaggccaccaag
ggcacacggggactggaggccaccattgaacacatcaaacaggaactagctgtgttcagc
aatggcgatcctccccccaagacgtccactccagaggatttcatccgcatgaccaaaggc
atcacccaggcaacagccaaagcagtggctgctgggaactcgtgtcgccaggaggacgta
atcgctacggccaacctgagcaggagggccatcgccgacatgctgcactcgtgcaagcaa
gccgcctaccacccagaggtcagcaaggaagttcagaaccgggccctgcgctatggcaac
gagtgtgccttgggctacctgggtctgctggagcatgtgctagtgccgatcatccagaag
cccagccacgagctcaagcagcagttggctaactactccaagcgcgtggcaggctccgtc
accgagctcatccaggccgccgaggccatgaagggaacggaatgggtggaccccgaggac
cccacggtcatcgctgagaacgagcttctgggagctgctgctgccattgaagcagccgcc
aggaaactggagctgctgaggccccgcaccaaacccaaggaagcggacgagagcctgaac
ttcgaggagcagatcctggaggcggccaaatcgatcgcagccgccaccagtgctctggtc
aaagctgcctcagccgcccagagggaactggtggcccaagggaaggtcggtgcctgccca
gccaatgcagtggatgatggacagtggtctcaaggtctcatttcagccgcccgaatggtt
gctgcggcgaccagcaacctgtgcgaggcggccaactcggcggtgcagggccacgccagc
gaggagaagctcgtcagctcggccaagcaggtgtctgcctccactgcccagctcctggtg
gcctgcaaggtcaaggctgaccaggactcccagaccatgaagaggctacaggctgccgga
aatgctgttaagagggcctccgatagcctggtgaaggcggcacagaaagcagcctttgac
gcccaagacgagcaggccgtggttgttaagagcaagatggtgggaggcattgctcagatc
attgctgcccaggaggaaatgctgaggaaggagagggagttggacgaggccagaaagaag
ctggccaccatccgacagcagcagtacaagttcctgccctctgagctcagggaggacggg
caggagcagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249374
Entry
112249374         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: talin-2-like
  KO
K06271  talin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112249374
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112249374
  Exosomal proteins of other cancer cells
   112249374
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP Myosin_TH1 RA
Other DBs
NCBI-GeneID: 112249374
NCBI-ProteinID: XP_024275005
LinkDB
Position
4
AA seq 2541 aa
MVALSLKICVCQCNLVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDIIEYKKKQRPLKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVMEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVEETETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
AGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGNEKKIFQVGPNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVEEKTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGVIRSGSIGAESLSMGTMPSAQQQVIM
GQMHRGHMPPLSSAQQALMGTINTSMQAVQQAQADLGEVDNLPPLGQDMASKVWIQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
IEDDTGGSNDLMGAARNLAGAVSDLLKAVEPASGEPRQTVLSAAGSIGQASGDLLLQIGE
NESDERFQEVLMILAKAVANAAAMMVLKAKNVAQVADDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVQACLSATVDGEMLKQVSSAASVVGQA
LGDLLEHVCHYASHGEPIGRYDQATDTIMTVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEVEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAASQNAAASNKNTAAHQQLVQSCKA
MADHIPQLVQGVRGSQAQPEDLTTQLSLIITSQNFLQPGSKMVTSAKSSVPTVMDQAAAM
QLGQCAKNLATSLAELRTAAQKANEACGPMEIHSALTAVQTLKTELQDAKMAAIDMQLKP
LPGESMEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHYTGLAARETAQALKTLAQAARGV
AASTTNPQAAASMLDSACDVMEGSAMLIHEAKQALVSPGDSESQQRLAQVAKSVSHSLNN
CVNCLPGQKDVDMALRSIGEASKKLLGETLPPSTRSFQEAQSELNQTAADLNQSAGDVVH
ASRGSSTQLADASGKFREDFDDFLDAGIEMAGHTQRKDEQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAANAKNLLAAAARAVTESINQLITLATQQAPGQKECDNALRELEAVKGMLA
NPNEPVSNLSYFHCIESVMENSKVLGESMAGISQNCKTGDVPAFGGCVGLASKALCGLTE
AAGQASYLVGVSDPNSQAGHQGLVDAIQFARANQAIQMACQNLVDPDSSPSQVLSSATSC
STSALCNACRLASSKTANPTAKRHLSSXCQGVANSKANLVKTIKALDGDFSQENRNTCLV
ATAPLIEAVENLTAFASNPEFASSPAQISNEGSAAQVPILQSARSMLDSSTHLLKTARSL
VINPKDPPTWSVLAGHSRTVSDSIKGLITAIRDKAPGQRECDYSIDNINRCIRNIEQASL
AAVSQNLASRDDISLEALQEQLTSTVQEIGYLINPISTAARGEAAQLGHKVTQLAGYFEP
LIRASVGVASKLQDHQQQMTFLDQTKTLAESALQMIYAAKEGGGNPKASHTHDAIAEAAQ
LMKEAVDDIMVTLNEAASEGGMVGAMVDSIAEAMGMXLDEGTSPEPEGSFVDYQTTMVKY
SKAIAVTAQEMMTKSVTCPEELGGLASRVTTDYSQLALQGRLAAHTAEPQEIGFQIKAGV
QELGHGCIFLVQKAGALQITPSDNYTKRELIECARTVTEKVSMVLSALQAGNKGTQACIT
AASAVSGIIAELDTTIMFASAGTLNAENDESFADHRENILKTAKALVEDTKMLVSGAASG
QDKLAQAAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELIGATKC
AAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATXECIKQELTVF
QSKDVPEKSTTPEEFIRMTKGITTATAKAVAAGNSARQEDVISTANLSRKAIFDMLTTCK
QAAYHQEVNKDVRSRALLYGTECTTGYIDLLEHVLLVLQGPTAEQKQQLVFYSKRVAGAV
TELIQTAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLD
FEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAVDDGQWSQGLISAARMV
AAATSNLCEAANASVQGQASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAG
NAVKRASDNLVRAAQKAAFHKADDDNVVVKTKFVGGIAQIIAAQEEMLRKERELEEARKK
LAQIRQQQYKFLPSELRENEN
NT seq 7626 nt   +upstreamnt  +downstreamnt
atggtggccctgtccctgaagatctgcgtctgccagtgcaacctggtgaagaccatgcag
tttgagccatccacggccgtctacgacgcctgcagaatcatcagagagagggttcccgaa
gcccagactggacaagcctcagactacggtctgttcctttctgatgaggaccccaggaaa
ggcatctggctggagtcaggaagaactctggattattacatgctgcggaatggggatatc
attgaatacaagaagaaacagaggccattgaagatcaagatgctggatggagctgtgaaa
accatcatggtggacgactccaaaacagtgggagagctgctagtgacgatatgcagtaga
ataggaatcaccaactacgaggagtactctctgatccaggaggtaatggaggagaagaag
gaggatgggacgggcaccctgaagaaagacaggactctgctccgagatgagaggaagatg
gagaaactcaaagccaagcttcacacagacgacgacttaaactggcttgaccacagcaga
acgttccgtgagcagggggtggaggagaccgaaactcttctgctcaggaggaagttcttc
tactcagaccagaacgtggactcacgagacccggtccagctcaacctgctctacgtccag
gcacgagatgacatcctaaatggttctcaccctgtgtccttcgacaaggcctgtgagttt
gcagggattcaggctcagatccagtttggaccgcacatagaacacaaacacaagcctgga
ttcctagacctcaaggagtttctacctaaagaatatatcaagcagcgagggaatgaaaag
aaaatctttcaggttggtccaaactgtggtgagatgacagagatagaagctaaagtaaag
tacgtgaagctagccaggtccctaaggacatacggagtgtctttcttcctggtgaaggag
aagatgaagagtaagaataagctggtccccaggctgttggggataaccaaagagtcagtg
atgagggtggaggagaagaccaaagacgtggtgcaggagtggcccctcaccactgtaaag
agatgggccgcctcgcccaagagcttcaccctggattttggggagtaccaggagagctac
tactcagtccagaccactgagggagaacagatctctcagctcatcgctggatacattgac
atcatcctcaaaaagaagcaaagtaaagaccgttttggtttagaaggagatgaagaatcc
accatgctggaagaatctgtctcccctaagaagtcgacgatcctgcagcagcagtttaac
cgtgtgggtcgtgtggagcatggctctgtggctctaccaggggtgatcaggtctggctct
ataggagcagagtctctcagcatgggcaccatgccttctgcacagcaacaggtcatcatg
ggacagatgcaccgaggacacatgccaccactgagctcggcccagcaggccctgatgggg
accatcaacaccagtatgcaggcagtacagcaggcacaggctgatctgggggaggtggac
aacctgcctcctctgggacaggacatggcrtccaaggtgtggatccagaacaaggtggat
gagtccaaacatgagatccactcccaggtggacgccatcaccgcaggaacagcttctgtg
gtcaacctcaccgctggtgacccgacagacacagactacactgcagtgggctgtgccatc
accaccatctcctccaacctgacagagatgtctaagggtgtgaagctactggctgctctt
atagaggacgacacgggcgggagcaatgaccttatgggtgccgctaggaaccttgcyggg
gccgtctctgacctgctcaaggctgtggagcctgcctccggagagccccgtcagactgtg
ctgagtgcagcaggcagtataggccaggccagtggggacctgctgcttcagataggagag
aacgagtcagacgagaggttccaggaggtgctgatgatcctggccaaggcggtggccaac
gcggcagccatgatggtgctgaaggcgaagaatgtggcccaggtggcagacgacacggtc
ctacagaacagagtaatcgctgctgccacgcagtgtgccctctccacctcccagctggtg
gcctgtgccaaggtggtgagtcccaccatcagctccccagtgtgccaggagcagctgatt
gaggcagggaagctggtagaccgctcagtggagggctgtgtccaggcctgtctgtctgcc
acagtcgacggggagatgctgaagcaggtgagttctgcagccagtgttgtcggtcaggcc
ctgggggacctgctggagcacgtatgccactacgcctcccacggcgagcccattggtcgc
tacgaccaggccaccgacaccatcatgaccgtaacagagagcatcttcagctccatggga
gacgcaggagagatggttcgtcaggccagggtcctggctcaggccacctctgacctggtg
aatgccatgcggtcagatgctgaggtggaagtggatgttgacaactctaagaagctactt
gctgcagctaaactactggcagacgccacagccaggatggtggaggctgctaagggtgca
gcggcatacccagagaacgaggaccagcagcagagactgagggaggcggctgagggctta
cgcgtggccaccaacgctgcagctcagaacgccatcaagaagaagctcattaacaggcta
gagaatgccgccaagcaagctgcagctgcagccacccagactatcgctgcctcccagaat
gcagcagcctccaataagaacactgccgcacaccagcaattggtgcagagctgcaaggcc
atggcagaccacattccccagctggtccagggggtaaggggcagccaggcccagcctgaa
gacctcactacccagctatccctcatcatcaccagtcagaacttcctacagcctggcagt
aagatggtgacatcagcgaagtcgtctgttcccacggtgatggaccaggccgctgctatg
cagctgggtcagtgtgccaagaacctggccaccagcctggcagagctcagaaccgcagca
cagaaggccaatgaagcctgcggccccatggagatccactcagctctcacagccgtccag
actctgaagactgagctccaagacgccaagatggctgccatagacatgcagctgaaacca
ctacctggagaatcgatggagaagtgtgctcaggacctgggcagcacctccaagtctgtg
ggatcctccatggctcagctgctcacctgtgctgcacagggcaatgaacactacacaggg
ttagcagccagagagacagcccaggccctgaagactctagcccaggcagcgcggggcgtg
gcagcctctaccaccaaccctcaggcagcggcgtccatgttggattcagcctgcgatgtt
atggaaggttcggccatgttgatccatgaggccaagcaggccctggtctctcccggtgac
tcagagagccagcagaggctagcccaggtggccaagtctgtgtcccactctctgaataac
tgtgtcaactgtctgcctggccagaaggatgtggacatggccctcaggagcattggagag
gccagcaagaaactgctgggagaaacgctccctccatccaccaggtcgttccaggaggcc
caaagcgagctgaaccagaccgcagcagatctgaaccaatcagcaggagacgtggtccac
gcctcccgcggttccagcacccagctcgcagacgcatctgggaagttcagagaagacttt
gatgacttcttggacgctggcattgagatggctgggcacactcagaggaaagatgagcag
atccaggtgataggtaacctgaagaacatctccatggcttccagcaagctgctcctggca
gccaagtctctgtctgtagaccctggggcagctaacgccaagaaccttctggctgctgct
gcaagagcagtgacagagagcattaaccagctaatcacactggccacacagcaggccccg
ggacagaaggagtgtgacaatgccctacgagagctggaggcggtgaaaggaatgttagcc
aaccccaacgagccagtcagcaacctctcctacttccactgcatcgagagcgtcatggag
aactccaaggtcctgggagagtccatggctggcatttctcagaactgtaaaaccggggat
gtgccagcatttgggggctgtgtgggactggcctccaaggccctgtgtgggctcactgag
gctgcaggacaggcctcctacctggtgggcgtrtctgaccccaacagtcaggcagggcat
cagggattggtcgacgccatccagtttgcacgagccaatcaggcgatccagatggcctgt
cagaacctggtggatccggacagcagcccctcacaggtgctgtcgtctgccacctcgtgc
agcacatcagctctttgcaacgcctgtcgcctggcctcctccaagacagccaaccccaca
gccaagagacatttgtccagtnnctgccaaggagtggccaacagcaaagccaacctggtc
aaaactataaaggctctggatggtgatttctctcaggagaataggaacacgtgtctggtg
gccacagctccactcatagaggctgttgagaacctcacagcgtttgcgtctaatccagag
ttcgccagcagccctgctcagatcagcaatgagggctctgccgctcaggtgcccatcctc
caatcagctcgctctatgctggacagctccacccacctgctgaagactgcacgttcactg
gttattaaccccaaagacccacccacctggtcggtcctggctggccactctcggactgtg
tccgactccatcaaaggtctcatcacggccatcagggacaaggctccaggccagagggag
tgtgactactccatagataacatcaacagatgtatccggaacattgagcaggcatcgcta
gccgcagtcagccagaacctggccagcagggatgacatctcactggaggccttgcaagag
cagctgacgtccacagtgcaagagattggatacctaatcaacccaatatctacagctgct
agaggggaagctgcccaactaggacacaaggtgacccagctggcgggctactttgagcct
ctgatcagggcgtcggtgggcgtggcgtctaagctgcaggaccaccagcagcagatgacc
ttcctggaccagactaagaccctggcagagtccgccctgcagatgatctacgcagccaag
gagggaggaggaaaccccaaggcgtcccatacccatgatgccatagctgaggctgctcag
ctgatgaaggaggcggtggatgacatcatggtgaccctgaacgaggccgccagcgaaggg
ggtatggtgggcgccatggtggactccattgctgaggccatgggcatgtgactggacgag
gggacctctcctgaaccagaaggatcgtttgtagactaccagactaccatggtgaaatac
tccaaggccattgcggtcaccgcccaggaaatgatgaccaagtctgtgacgtgtccagag
gagctggggggtctggcctctcgggtgaccacagactacagccagctggccctgcaggga
cgtctggccgcgcacactgcagaaccccaggagattggtttccagatcaaggctggtgtt
caggagctgggtcacggctgtatcttcctggtgcagaaggctggagcgctgcagatcacc
ccctcagacaattacaccaagagagagctcatagagtgtgcccgcactgtcacagagaag
gtgtcgatggtgctgtcggccctacaggctggtaataagggcactcaggcctgcatcaca
gctgccagtgctgtctctggcatcatcgctgaactggacaccaccatcatgttcgcttcc
gctggcacactcaacgcagagaatgacgagtccttcgctgaccacagggagaacatattg
aagacagcgaaggctttggtggaggacactaagatgttggtgtctggagcagcgtccggt
caggacaaactagcccaagctgcccagtcctcagctaagaccatcacacagctcactgac
gtggtcaaactgggtgccgccagcatcggctctgacgacccagagacacaggtggttctg
atcaacgctgtgaaagacgtggccaaggccctggctgagctcataggagccactaagtgt
gctgcgggcaaggctgcagacgacccatccatgtaccagctgaagagtgctgccaaggtg
atggtgaccaacgtgacgtccctgctgaagacggtgaaggctgtggaggacgaggccacg
cgggggaccagagccctggaggccaccrttgaatgtattaaacaggaactcacggtgttc
cagtctaaagacgtcccggagaagtcgaccacgcctgaagagttcatccgcatgaccaag
ggcatcaccacggcaacagccaaagcagtggcggctgggaactctgcacgacaggaggat
gtgatctccacagctaacctgagtcgcaaggccatcttcgacatgctgaccacatgcaag
caagcagcttaccaccaggaggtgaacaaggacgtacggagcagagcactgctctacggg
acagagtgcaccacaggttacattgacctactggagcatgtgctgctggtcctccagggg
cctacagcagagcagaagcagcagctggtgttctactctaaacgtgttgctggggctgtt
actgaactcatccagactgctgaggccatgaaaggcacagagtgggtggacccagaggac
cccacagtgatagcagagackgagctgttgggggcggcagcgtccatcgaagcagcagct
aagaaactggagcagctgaaacccagagccaagcccaagcaagcagatgaaacgctggac
tttgaggagcagatcctggaagcagctaagtccatcgctgcggccaccagtgccctggtc
aagtctgcctcagctgcccagagagagctggtggctcagggcaaggtgggctccattcca
gctaacgcagtggatgatggtcagtggtcccagggcctcatctcagcggcccggatggta
gcagcagccaccagtaacctgtgtgaggcagctaatgcctcggtccagggccaagccagc
gaggagaagctgatctcgtcagccaagcaggtggcagcctccacagcccagctcctagtg
gcctgtaaggttaaagctgaccaggactctgaggccatgaggagactgcaggctgctggt
aacgcagtaaagagggcgtcggacaacctggtccgagcggcccagaaagctgcgttccac
aargcagacgatgacaacgtggtggtcaagaccaagtttgtgggaggaatcgctcagatc
atagcagcccaggaggagatgctaaggaaggagagagagctggaggaggccaggaagaag
ctggctcagatcagacagcagcagtacaagttcttacccagtgaactacgagagaatgag
aactga

DBGET integrated database retrieval system