KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218594
Entry
112218594         CDS       T05605                                 

Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218594
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112218594
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   112218594
SSDB
Motif
Pfam: RasGEF RhoGEF RasGEF_N PH GOLGA2L5 PH_11 IQ DUF641
Other DBs
NCBI-GeneID: 112218594
NCBI-ProteinID: XP_024235277
LinkDB
Position
19
AA seq 1259 aa
MQKGIRLNDGHVTYLGLLAKKDGTRRGCLSKRSSDNTKWHTKWFALLQNMLFYFESESSS
RPAGLYLLEGCVCDRAPSPKPSQSSKECLEKQYYFTVNFTHENQKALELRTEDVKDGDEW
VAAITHASYRNLATEHETLMQKYLHLIQIVETEKTVAKQLRQQIEDGEIEIERLKSEISG
LHKDNGKIQSSPTADPSEDDDSELKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMR
KRNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFL
HQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKL
LKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERTSLDYAKSKLEEL
SRIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRL
GSLTLKKEGERQCFLFSKHVIICTRGSGGKLHLTKNGVVSLIDCTLLEDPEVTDDESKPD
KGVQDMEHLDFKIVVEPKEGQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFE
ENSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDF
LNTFLHSYRVFTSADVVLDKLITIYKKPISAIPARSLELFFASSQNNKLLYGEPPKSPRA
SRKFSSPPPLAITKTSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMSPFS
KTTLDINKLYVTSPITSKIPDEGEGKTDKAEETIVSKQDISVPEESDIDQNQSDDADPET
SPIKSPTTPKNLKCKNSSEFSLFSYNNGTVMSSCRPEMDNNNRSALSAASAFAIATAGAN
EGTPTKEKYRRMSLASSGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFESNTE
LKLKVIAFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQISLEEVTQLASVGKAEAF
ESHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNERTPYIMKTTKHFNDISNLIA
TEILRCDDVTTRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSVFRLKKTWLKVSKQ
TKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDKLVN
FSKMRMISHIIREIRQFQQTAYKIDHQPMAAQYLLDNSSVLDEESLYEASLRIEPKVNN
NT seq 3780 nt   +upstreamnt  +downstreamnt
atgcagaagggaatacgactgaatgatggtcatgtcacctacctgggtcttttggcaaag
aaggatggtacgagacgaggttgcttgagcaaaaggagctcagacaacacaaaatggcac
acaaagtggttcgctttattacaaaatatgctgttttattttgagagcgagtccagctct
cgacctgcgggattatacctgttggagggatgtgtgtgtgacagagcgccgtcacctaaa
ccatcacaatcatccaaagagtgtttagaaaagcagtactacttcactgtaaatttcacc
catgaaaaccagaaagccctggagttgcgtacagaggatgtcaaggacggtgatgaatgg
gtggctgcaataacacatgccagttacaggaacctggccacggagcacgagacgctcatg
cagaagtatctccatctaattcagatcgtagagacagagaaaacggttgctaagcaactt
cgacaacagatagaggacggggaaatagagattgaacggctaaaatcagagatttccggg
ctgcacaaagacaatgggaagatccagtcgagtccaacagccgaccccagtgaagatgat
gactctgaactcaagaaaataaaaaaagtgcagagtttcctacgaggctggatgtgcagg
aggaagtggaagaccatcatccaggactacatccggtctccccacgccgagagcatgagg
aagaggaaccaggtggtgttcagcatgctggactctgaggctgagtacgtccagcagctc
cacatcctggtcaacaatttcctccgacccctccgtatggccgccagctccaagaaacca
cccatcacccatgacgacgtcagcagcatcttcctcaacagtgagaccatcatgtttctg
catcaaatattctaccaagggttgaaagcaagaatagcaagctggccaacattagttttg
gctgacctgtttgacatcctgctgccaatgttgaacatctaccaggagtttgtgaggaac
caccaatacagtctgcagatcctggcacactgtaaacagaaccgagactttgacaagctg
ctgaagcagtatgaggccaagccagactgtgaggagaggactctggagaccttcctcacc
taccccatgttccagattccccgctacattcttactctccatgagctcctggcccacaca
ccacatgagcatgtggagaggacaagtctggactacgccaagtcaaagctggaggagctg
tccagaatcatgcatgacgaggtgagtgagacagagaacatcaggaagaacctggccatt
gagcgcatgattgtagagggctgtgagatcctccttgacaccagccagacgtttgtcaga
caaggctctctcatccaggtgccaatgagtgagaagggaaagatcacccgtgggcgactg
ggctctctgactctgaagaaggaaggggagaggcagtgcttcctcttctccaagcatgtc
atcatctgcaccaggggctctggagggaagctgcacctcaccaagaatggcgtggtgtct
cttattgactgcactcttctggaagaccccgaggtgacagatgatgagtccaaaccagac
aagggtgtacaggacatggagcacctggactttaaaatcgtggtggagcctaaagaaggc
cagtcattcacagtgatcctggtggcctcctcgcgacaggagaaatctgcctggaccagt
gacatcagccagtgcatagacaacatccgctgcaatgggcttatgatgaatgcatttgag
gagaactctaaagtcaccgtgccacagatgatcaagtctgacgccagcctgtactgcgat
gacgtggacatccgtttcagtaagatgatgaactcatgtaaggtgctgcagatccgctat
gccagtgtggaaagacttctagagagattgaccgacctgcgcttcctctcgatcgacttc
ctcaacaccttcctgcattcctaccgcgtgttcaccagcgccgatgtggtgctggacaag
ctcatcactatctacaaaaagcccatcagtgccatcccagcccgatccctggagttgttc
ttcgccagcagtcagaacaataaactcctatatggggagcctcccaaatcccccagggcc
agccgtaagttttcctccccccctcccctggccatcaccaagacatcgtcccccaaccgc
cgccgtaaactctccctcaacatccccatcatcactgggggcaaggctctggacctggcc
gcccttagctgctcctccaacggctatgcaagcatgtactcctccatgtcccccttcagc
aagaccaccttggacatcaataagctttatgtcaccagccccatcaccagtaagatccct
gacgagggagagggcaagacagacaaggcagaggagaccattgtgtctaaacaagatatt
tcagttccggaggaaagtgacattgaccaaaaccagagcgatgacgcagacccggaaacg
tctcctatcaagtcgccaaccacccccaaaaacttgaaatgcaaaaactcttcagaattc
tccctgttttcctacaataatggcacggtgatgtcatcgtgccgccctgagatggacaac
aacaatcgcagtgccctctctgcagcctccgccttcgccattgccacggcaggagccaat
gagggcacgcccaccaaggagaagtaccgccgcatgtccctggctagctcagggttccca
acagaccagaggaatggggacaaagagtttgtaatccgaagggctgcaaccaacagagtc
ctgaatgttctgaggcactgggtgtcaaaacactctcaggactttgagagtaacactgag
ctgaagctgaaggtgatagccttcctggaggaagtgatgcatgacccggagctgctgaca
caggagaggaaagcagccgccaacatcatcaggaccctgacacaggaggacccaggtgac
aatcagatcagcctggaggaggtgacacagctggcgtcagtaggaaaggcggaagcgttt
gagagccattctgccctggagatagcagagcagctcaccctactggaccacctggtattt
aaggtcatcccatatgaagagttctttggtcaaggctggatgaagaatgacaagaatgaa
aggacaccatatatcatgaaaacaacaaagcatttcaatgatatcagtaacctgattgcc
actgagatcctgcgttgtgacgatgtgaccacacgggtggcggtgatggagaagtgggtg
gcggtggcggacatctgccgctgtctccataactacaacgctgtgctggagatcacctcc
tccctcaaccgcagctctgtgttccgtctcaagaagacctggctcaaagtgtccaagcag
actaaaaccgtaattgacaagctgcagaagttggtttcgtcagaggggaggttcaaaaac
ctaagagaggctttaaagaactgtgaccctccctgtgtaccatacctggggatgtacctc
actgatctggctttcattgaggaggggacgcccaattacactgaggacaaattagtcaac
ttctcaaagatgaggatgatttcccatatcatcagagaaattagacaattccagcaaaca
gcatacaagattgatcatcagccaatggcagcacagtatttgctggacaacagctctgtt
ctggatgaagaaagcctgtatgaagcctctctcagaatcgagcctaaagtcaacaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245255
Entry
112245255         CDS       T05605                                 

Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1-like
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112245255
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112245255
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   112245255
SSDB
Motif
Pfam: RasGEF RhoGEF PH RasGEF_N GOLGA2L5 PH_11 PH_13 IQ Nup54 DUF641
Other DBs
NCBI-GeneID: 112245255
NCBI-ProteinID: XP_024269041
LinkDB
Position
Unknown
AA seq 1260 aa
MQKGIRFNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSS
RPAGLYLLEGCVCDRAPSPKPSQSSKECLEKQYYFTVNFTHENQKALELRTEDVKDCDEW
VAAITHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSELSG
LHKDNGKIQSSPTAEPSEDDDSELKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMR
KRNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFL
HQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKL
LKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERTSLDYAKSKLEEL
SRIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRL
GSLSLKKEGERQCFLFSKHVIICTRGSGGKLHLTKNGVVSLIDCTLLEDPEGTDDESKPD
KGVQDMEHLDFKIVVEPKEGQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFE
ENSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDF
LNTFLHSYRVFTSANVVLDKLITIYKKPISAIPARSLELFFASSQNNKLLYGEPPKSPRA
SRKFSSPPPLAITKTSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMSPFS
KTTLDINKLYVTSPITSKIPAEGEGKTDKAEETTVSKQDISVPEESDIDQSQSDDAEPET
SPIKSPTTPQKNVKCKNSSEFSLFSYNNGTVMSSCRPEMDNNNRSALSAASAFAIATAGA
NEGTPTKEKYRRMSLASTGFQTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFESNT
ELKLKVIAFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQISLEEVKQLASVGKAEA
FESHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKTERTPYIMKTTKHFNDISNLI
ATEILRCDDVTTRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSVFRLKKTWLKVSK
QTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDKLV
NFSKMRMISHIIREIRQFQQTAYKIDHQPKAAQYLLDNSSVLDEESLYEASLRIEPKVNN
NT seq 3783 nt   +upstreamnt  +downstreamnt
atgcagaagggaatacgatttaatgatgggcatgtcacctacctgggtcttttggcaaag
aaggatggtacgaggcgaggttgcttgagcaaaaagagctcagacaacactaaatggcac
acaaagtggttcgctttattacaaaatatgctgttttattttgagagcgagtccagctct
cgacccgcgggattatacctgttggaggggtgtgtgtgtgacagagcgccgtcaccgaaa
ccctcacaatcatccaaggagtgtttagaaaagcagtactacttcaccgtaaatttcacc
catgaaaaccagaaagccctggagttgcgtacagaggatgtaaaggactgcgatgaatgg
gtggctgcaataacacatgccagttacaggaacctggccacggagcacgagacactcatg
cagaagtatctccatctactccagatcgtggagacagagaaaacggttgctaagcaactt
cgacaacagatagaggacggggaaatagagattgaacggctaaaatcagagctttccggg
ctgcacaaagacaacgggaagatccagtcaagtccaacagccgaacccagcgaagatgat
gactctgaactcaagaaaatcaaaaaagtgcagagtttcctgcgaggctggatgtgcagg
aggaagtggaaaaccatcatccaggactacatccggtctccccacgcagagagcatgagg
aagaggaaccaggtggtgttcagcatgctggactctgaggctgagtatgtccagcagctc
cacatcctggtcaacaacttccttcgacccctccgtatggccgccagctccaagaaacca
cccatcacccacgacgacgtcagcagcatcttcctcaacagtgagaccatcatgtttctg
catcaaatattctaccaagggttgaaagcaagaatagcaagctggccaacattagttttg
gcggacctgtttgatattctactgcccatgctaaacatctaccaggagtttgtgaggaac
caccagtacagtctgcagattctggcccactgtaaacagaaccgagactttgacaagctg
ctgaagcagtatgaggccaagcccgactgtgaggagaggactctggagaccttcctcacc
taccccatgttccagattccccgctacattcttacactccatgagctcctggcccacaca
ccacatgagcatgtggagaggacgagtctggactatgccaagtcaaagctggaggagctg
tccagaatcatgcatgatgaggtgagcgagacagagaacatcaggaagaacctggccatt
gagcgcatgatcgtagaaggctgcgagatcctccttgacaccagccagacattcgtcaga
caaggctctctcatccaggtgccaatgagtgagaagggcaagatcacccgtgggcgactg
ggctctctgtctctgaagaaggagggggagaggcagtgcttcctcttctctaagcatgtc
attatctgcaccaggggctctggaggaaaactgcacctcaccaagaatggcgtggtctct
cttattgactgcactcttctggaagaccccgaggggacagatgatgagtccaaaccagac
aagggtgtacaggacatggagcatctggactttaagatcgtggtggagcctaaagaaggc
cagtcgtttacagtgatcctggtggcctcctcgcggcaggagaaatctgcatggaccagt
gacatcagccagtgcatagacaacatccgctgcaatgggcttatgatgaacgcatttgag
gagaactctaaagtcaccgtgccacagatgatcaagtccgacgccagcctgtactgtgac
gacgtggacatccgtttcagtaagatgatgaactcgtgtaaggtgttgcagatccgctat
gccagcgtggagagactcctggagaggctgacagacctgcgcttcctctccattgacttt
ctcaacaccttcctgcactcctaccgcgtgttcaccagtgccaacgtggtgctggacaaa
ctcatcaccatctacaagaaacccatcagtgccatcccagcccgatccctggagttgttc
ttcgccagcagtcagaacaataaactcctatatggggagcctcccaaatcccccagggcc
agccgtaagttctcttccccccctcctctggccatcaccaagacatcgtcccccaaccgc
cggcgtaaactctcactcaacatccccatcatcactgggggaaaggctctggacctggcc
gccctcagctgctcctccaatggctatgcaagcatgtactcctccatgtcccccttcagc
aagaccaccctggacatcaacaagttatatgtcaccagtccaatcaccagcaagatccct
gctgagggagagggcaagacagacaaggcagaggagaccactgtgtctaaacaagatatt
tcagttccggaggaaagtgacattgaccaaagccagagcgatgatgcagagccagaaacg
tctcctatcaagtcgccaaccactcctcaaaaaaacgtgaagtgcaaaaactcctcagaa
ttctccctgttctcatacaacaatggcacagtgatgtcttcgtgtcgccctgagatggac
aacaacaaccgcagtgccctctctgcagcctccgccttcgccatcgccacggcaggagcc
aatgagggcacgcccaccaaggagaagtatcgccgcatgtccctggccagcacagggttc
caaacagaccagaggaatggggacaaagagtttgtcatccgaagggctgcaaccaacaga
gtcctaaatgttctgaggcactgggtgtcaaaacactctcaggactttgagagtaacact
gagctgaagctgaaggtcatagccttcctggaggaggtgatgcatgacccagagctgctg
acccaggagaggaaagcagccgccaacatcatcaggaccctgacacaggaggaccctggt
gacaatcagatcagcctggaggaggttaaacagctggcgtcagtagggaaggcagaggca
tttgagagccattctgccctggagatagcagagcagctcaccctactagaccacctggtg
tttaaggtcatcccatatgaagagttctttggtcaaggctggatgaagaatgacaagact
gaaaggacaccatatatcatgaaaacaacaaagcacttcaatgatatcagtaacctgatt
gccacggagatcctgcgttgtgatgatgtgaccacgcgggtggcggtgatggagaagtgg
gtggcggtggcggacatctgccgctgtctccataactacaacgctgtgctggagatcacc
tcctccctcaaccgcagctctgtgttccgcctcaagaagacctggctcaaagtgtccaag
cagactaaaaccgtcattgacaagctgcagaagttggtttcgtcagaggggaggttcaaa
aacctgagggaggctttaaagaactgtgaccctccctgtgtaccatacctggggatgtac
ctcactgatctggctttcattgaggaggggacgcccaactacactgaggacaaattagtc
aacttctcaaagatgaggatgatttcacatatcatcagagaaattagacaattccagcaa
acagcatacaagattgatcatcagccaaaggcagcacagtatttgctggacaacagctct
gttctggatgaagaaagcctgtatgaagcctctctcagaattgagcctaaagtcaacaac
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252413
Entry
112252413         CDS       T05605                                 

Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1-like
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252413
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252413
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112252413
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   112252413
SSDB
Motif
Pfam: RasGEF RhoGEF PH RasGEF_N GOLGA2L5 PH_11 PH_13 IQ Nup54 DUF641
Other DBs
NCBI-GeneID: 112252413
NCBI-ProteinID: XP_024279382
LinkDB
Position
6
AA seq 1260 aa
MQKGIRFNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSS
RPAGLYLLEGCVCDRAPSPKPSQSSKECLEKQYYFTVNFTHENQKALELRTEDVKDCDEW
VAAITHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSELSG
LHKDNGKIQSSPTAEPSEDDDSELKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMR
KRNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFL
HQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKL
LKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERTSLDYAKSKLEEL
SRIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRL
GSLSLKKEGERQCFLFSKHVIICTRGSGGKLHLTKNGVVSLIDCTLLEDPEGTDDESKPD
KGVQDMEHLDFKIVVEPKEGQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFE
ENSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDF
LNTFLHSYRVFTSANVVLDKLITIYKKPISAIPARSLELFFASSQNNKLLYGEPPKSPRA
SRKFSSPPPLAITKTSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMSPFS
KTTLDINKLYVTSPITSKIPAEGEGKTDKAEETTVSKQDISVPEESDIDQSQSDDAEPET
SPIKSPTTPQKNVKCKNSSEFSLFSYNNGTVMSSCRPEMDNNNRSALSAASAFAIATAGA
NEGTPTKEKYRRMSLASTGFQTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFESNT
ELKLKVIAFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQISLEEVKQLASVGKAEA
FESHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKTERTPYIMKTTKHFNDISNLI
ATEILRCDDVTTRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSVFRLKKTWLKVSK
QTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDKLV
NFSKMRMISHIIREIRQFQQTAYKIDHQPKAAQYLLDNSSVLDEESLYEASLRIEPKVNN
NT seq 3783 nt   +upstreamnt  +downstreamnt
atgcagaagggaatacgatttaatgatgggcatgtcacctacctgggtcttttggcaaag
aaggatggtacgaggcgaggttgcttgagcaaaaagagctcagacaacactaaatggcac
acaaagtggttcgctttattacaaaatatgctgttttattttgagagcgagtccagctct
cgacccgcgggattatacctgttggaggggtgtgtgtgtgacagagcgccgtcaccgaaa
ccctcacaatcatccaaggagtgtttagaaaagcagtactacttcaccgtaaatttcacc
catgaaaaccagaaagccctggagttgcgtacagaggatgtaaaggactgcgatgaatgg
gtggctgcaataacacatgccagttacaggaacctggccacggagcacgagacactcatg
cagaagtatctccatctactccagatcgtggagacagagaaaacggttgctaagcaactt
cgacaacagatagaggacggggaaatagagattgaacggctaaaatcagagctttccggg
ctgcacaaagacaacgggaagatccagtcaagtccaacagccgaacccagcgaagatgat
gactctgaactcaagaaaatcaaaaaagtgcagagtttcctgcgaggctggatgtgcagg
aggaagtggaaaaccatcatccaggactacatccggtctccccacgcagagagcatgagg
aagaggaaccaggtggtgttcagcatgctggactctgaggctgagtatgtccagcagctc
cacatcctggtcaacaacttccttcgacccctccgtatggccgccagctccaagaaacca
cccatcacccacgacgacgtcagcagcatcttcctcaacagtgagaccatcatgtttctg
catcaaatattctaccaagggttgaaagcaagaatagcaagctggccaacattagttttg
gcggacctgtttgatattctactgcccatgctaaacatctaccaggagtttgtgaggaac
caccagtacagtctgcagattctggcccactgtaaacagaaccgagactttgacaagctg
ctgaagcagtatgaggccaagcccgactgtgaggagaggactctggagaccttcctcacc
taccccatgttccagattccccgctacattcttacactccatgagctcctggcccacaca
ccacatgagcatgtggagaggacgagtctggactatgccaagtcaaagctggaggagctg
tccagaatcatgcatgatgaggtgagcgagacagagaacatcaggaagaacctggccatt
gagcgcatgatcgtagaaggctgcgagatcctccttgacaccagccagacattcgtcaga
caaggctctctcatccaggtgccaatgagtgagaagggcaagatcacccgtgggcgactg
ggctctctgtctctgaagaaggagggggagaggcagtgcttcctcttctctaagcatgtc
attatctgcaccaggggctctggaggaaaactgcacctcaccaagaatggcgtggtctct
cttattgactgcactcttctggaagaccccgaggggacagatgatgagtccaaaccagac
aagggtgtacaggacatggagcatctggactttaagatcgtggtggagcctaaagaaggc
cagtcgtttacagtgatcctggtggcctcctcgcggcaggagaaatctgcatggaccagt
gacatcagccagtgcatagacaacatccgctgcaatgggcttatgatgaacgcatttgag
gagaactctaaagtcaccgtgccacagatgatcaagtccgacgccagcctgtactgtgac
gacgtggacatccgtttcagtaagatgatgaactcgtgtaaggtgttgcagatccgctat
gccagcgtggagagactcctggagaggctgacagacctgcgcttcctctccattgacttt
ctcaacaccttcctgcactcctaccgcgtgttcaccagtgccaacgtggtgctggacaaa
ctcatcaccatctacaagaaacccatcagtgccatcccagcccgatccctggagttgttc
ttcgccagcagtcagaacaataaactcctatatggggagcctcccaaatcccccagggcc
agccgtaagttctcttccccccctcctctggccatcaccaagacatcgtcccccaaccgc
cggcgtaaactctcactcaacatccccatcatcactgggggaaaggctctggacctggcc
gccctcagctgctcctccaatggctatgcaagcatgtactcctccatgtcccccttcagc
aagaccaccctggacatcaacaagttatatgtcaccagtccaatcaccagcaagatccct
gctgagggagagggcaagacagacaaggcagaggagaccactgtgtctaaacaagatatt
tcagttccggaggaaagtgacattgaccaaagccagagcgatgatgcagagccagaaacg
tctcctatcaagtcgccaaccactcctcaaaaaaacgtgaagtgcaaaaactcctcagaa
ttctccctgttctcatacaacaatggcacagtgatgtcttcgtgtcgccctgagatggac
aacaacaaccgcagtgccctctctgcagcctccgccttcgccatcgccacggcaggagcc
aatgagggcacgcccaccaaggagaagtatcgccgcatgtccctggccagcacagggttc
caaacagaccagaggaatggggacaaagagtttgtcatccgaagggctgcaaccaacaga
gtcctaaatgttctgaggcactgggtgtcaaaacactctcaggactttgagagtaacact
gagctgaagctgaaggtcatagccttcctggaggaggtgatgcatgacccagagctgctg
acccaggagaggaaagcagccgccaacatcatcaggaccctgacacaggaggaccctggt
gacaatcagatcagcctggaggaggttaaacagctggcgtcagtagggaaggcagaggca
tttgagagccattctgccctggagatagcagagcagctcaccctactagaccacctggtg
tttaaggtcatcccatatgaagagttctttggtcaaggctggatgaagaatgacaagact
gaaaggacaccatatatcatgaaaacaacaaagcacttcaatgatatcagtaacctgatt
gccacggagatcctgcgttgtgatgatgtgaccacgcgggtggcggtgatggagaagtgg
gtggcggtggcggacatctgccgctgtctccataactacaacgctgtgctggagatcacc
tcctccctcaaccgcagctctgtgttccgcctcaagaagacctggctcaaagtgtccaag
cagactaaaaccgtcattgacaagctgcagaagttggtttcgtcagaggggaggttcaaa
aacctgagggaggctttaaagaactgtgaccctccctgtgtaccatacctggggatgtac
ctcactgatctggctttcattgaggaggggacgcccaactacactgaggacaaattagtc
aacttctcaaagatgaggatgatttcacatatcatcagagaaattagacaattccagcaa
acagcatacaagattgatcatcagccaaaggcagcacagtatttgctggacaacagctct
gttctggatgaagaaagcctgtatgaagcctctctcagaattgagcctaaagtcaacaac
tga

DBGET integrated database retrieval system