KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218668
Entry
112218668         CDS       T05605                                 

Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218668
   04012 ErbB signaling pathway
    112218668
   04370 VEGF signaling pathway
    112218668
   04371 Apelin signaling pathway
    112218668
   04068 FoxO signaling pathway
    112218668
   04150 mTOR signaling pathway
    112218668
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218668
   04140 Autophagy - animal
    112218668
   04137 Mitophagy - animal
    112218668
  09143 Cell growth and death
   04210 Apoptosis
    112218668
   04218 Cellular senescence
    112218668
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218668
   04540 Gap junction
    112218668
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112218668
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112218668
  09152 Endocrine system
   04910 Insulin signaling pathway
    112218668
   04912 GnRH signaling pathway
    112218668
   04916 Melanogenesis
    112218668
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112218668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112218668
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112218668
   04031 GTP-binding proteins [BR:otw04031]
    112218668
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112218668
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112218668
  Exosomal proteins of colorectal cancer cells
   112218668
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112218668
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin AAA_25
Other DBs
NCBI-GeneID: 112218668
NCBI-ProteinID: XP_024235436
LinkDB
Position
19
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc
atccagctcatccagaaccactttgtggatgaatacgaccctaccatagaggactcatac
aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatt
aagcgtgtgaaagactctgacgacgtgcccatggtcctggtgggtaataaatgtgacctc
ccatcgcgtaccgtggacactcggcaagcacaggaactggcccgcagctacggaattccc
tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgctagtg
agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac
tgcatgagctgccgctgtgtggtgtcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218714
Entry
112218714         CDS       T05605                                 

Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218714
   04012 ErbB signaling pathway
    112218714
   04370 VEGF signaling pathway
    112218714
   04371 Apelin signaling pathway
    112218714
   04068 FoxO signaling pathway
    112218714
   04150 mTOR signaling pathway
    112218714
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112218714
   04137 Mitophagy - animal
    112218714
  09143 Cell growth and death
   04210 Apoptosis
    112218714
   04218 Cellular senescence
    112218714
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112218714
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112218714
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112218714
  09152 Endocrine system
   04910 Insulin signaling pathway
    112218714
   04912 GnRH signaling pathway
    112218714
   04914 Progesterone-mediated oocyte maturation
    112218714
   04916 Melanogenesis
    112218714
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112218714
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112218714
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112218714
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112218714
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA AAA_25
Other DBs
NCBI-GeneID: 112218714
NCBI-ProteinID: XP_024235534
LinkDB
Position
19
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC
VKLKKCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatacaagctggtggtggtgggagcaggaggtgtgggcaagagcgcgctcacc
atccagctcattcagaaccactttgtggatgaatatgaccccaccatcgaggactcatac
aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt
caggaggagtacagcgctatgagggaccaatacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccactacagagagcagatc
aagcgggtgaaagactcagaagacgtgccaatggtgctggtggggaacaagtgtgacctg
ccgtcccggacggtggacaccaaacaggctcaggacttagcacgcagctacggcatcccc
ttcattgagacctcggccaaaacgagacagagagtggaggatgccttttacagtctggta
cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc
gtcaagcttaaaaagtgtgttgtgatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225639
Entry
112225639         CDS       T05605                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112225639
   04371 Apelin signaling pathway
    112225639
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112225639
   04137 Mitophagy - animal
    112225639
  09143 Cell growth and death
   04218 Cellular senescence
    112225639
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112225639
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112225639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112225639
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112225639
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin MMR_HSR1 Gtr1_RagA ATP_bind_1 FeoB_N AAA_16
Other DBs
NCBI-GeneID: 112225639
NCBI-ProteinID: XP_024245529
LinkDB
Position
26
AA seq 209 aa
MATSSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVSDYDPTIEDSYLKHTEIDGQ
WAILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAF
PMVLVANKVDLVHLRKITSDQGQEMAAKHNITYIETSAKDPPMNVDKAFHGLVRVIRQQI
PERSLKKKKKMKWRGERSTGSHKVHCVIL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcaaccagcagcgcggtccctagcgacaacctccccacttacaagctggtggtggtg
ggggacggaggggtggggaagagcgctctcaccatccagttctttcagaagatctttgtg
tctgactacgaccccaccatcgaggactcctacctgaaacacacagagatagacggacag
tgggccatcctggacgtgctggacacggcaggccaagaggagttcagtgctatgagggag
cagtacatgaggacgggggacggcttcctcatcgtgttctctgtgacagacaaggccagc
tttgaacatgtggaccgcttccaccagctcatcctcagggtgaaggacagggaggccttc
cccatggtgctggtggccaataaggtggacttggttcacctgcgcaaaatcaccagcgac
caggggcaggaaatggctgccaaacacaacattacatacattgagacaagtgccaaggat
cctcctatgaatgtggacaaggcgttccatggattagtcagggttataaggcagcagatc
ccagagaggagcctgaagaagaaaaagaagatgaagtggcgaggagaacgctctacgggt
tctcacaaagtccactgtgtcatcttatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226270
Entry
112226270         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226270
   04012 ErbB signaling pathway
    112226270
   04370 VEGF signaling pathway
    112226270
   04371 Apelin signaling pathway
    112226270
   04068 FoxO signaling pathway
    112226270
   04150 mTOR signaling pathway
    112226270
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112226270
   04137 Mitophagy - animal
    112226270
  09143 Cell growth and death
   04210 Apoptosis
    112226270
   04218 Cellular senescence
    112226270
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112226270
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226270
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112226270
  09152 Endocrine system
   04910 Insulin signaling pathway
    112226270
   04912 GnRH signaling pathway
    112226270
   04914 Progesterone-mediated oocyte maturation
    112226270
   04916 Melanogenesis
    112226270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112226270
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112226270
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112226270
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112226270
SSDB
Motif
Pfam: Ras Roc MMR_HSR1 Arf GTP_EFTU Septin
Other DBs
NCBI-GeneID: 112226270
NCBI-ProteinID: XP_024246411
LinkDB
Position
27
AA seq 214 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQIKQVRTVTVCLWCWWGTRVTW
ESERGEQAGSGAGPRYGVPFVETSAKTRQGVEEAFYSLVREIRRYXETNRSNKKSKKSTQ
RRCKPFYKPTQSHCTLHIAHNPPTHCSSFTTWET
NT seq 645 nt   +upstreamnt  +downstreamnt
atgactgagtataagcttgttgtggtgggtgctggaggtgttgggaagagtgccttaact
atccagctcatccagaatcactttgtggatgaatatgaccccaccatcgaggactcgtac
aggaagcaggtggtgattgacggagagacgtgtctgctggacatcctggacacagcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggggaaggcttcctttgt
gtgttcgccatcaacaacatcaagtcctttgaggatgttcacctgtacagagaacagatc
aaacaggtgaggacagtgacagtgtgcctatggtgctggtggggaacaagagtgacctgg
gagtcggagcgtggagagcaggcaggctcaggagctggcccgcgctatggtgtgcccttc
gtggagacctctgccaaaaccagacagggcgtggaggaggcgttctactctctagtcaga
gagatcaggaggtatnaagaaaccaaccgcagcaacaagaagagcaagaaaagcactcag
agacgttgcaaaccattctataaacccacacagtcacactgcacactgcacatagcccat
aacccccccacacactgcagttcctttaccacatgggagacgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237831
Entry
112237831         CDS       T05605                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237831
   04371 Apelin signaling pathway
    112237831
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112237831
   04137 Mitophagy - animal
    112237831
  09143 Cell growth and death
   04218 Cellular senescence
    112237831
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237831
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112237831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112237831
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112237831
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin MMR_HSR1 Gtr1_RagA ATP_bind_1 FeoB_N AAA_16 AAA_24
Other DBs
NCBI-GeneID: 112237831
NCBI-ProteinID: XP_024262202
LinkDB
Position
3
AA seq 209 aa
MATSSAVPSDNLLTYKLVVVGDGGVGKSALTIQFFQKIFVSDYDPTIEDSYLKHTEIDGQ
WAILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAF
PMVLVANKVDLVHLRKITSDQGQEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIRQQI
PERSLKKKKKMKWRGERSTGSHKVHCVIL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcaaccagcagcgcggtgcctagcgacaacctcctcacgtacaagctggtggtggtg
ggggatggtggagtggggaagagcgcgctcaccatccagttttttcagaagatctttgtg
tctgactatgaccccaccatcgaggactcctacctgaaacacacagagatagatggacag
tgggccatcctggacgtgctggatacagcaggccaagaggagttcagtgctatgagggag
cagtacatgaggacgggggatggcttcctcatcgtgttctctgtgacagacaaggccagc
tttgaacatgtggaccgcttccaccagctcatcctcagggtcaaagacagggaggccttc
cccatggtgctggtggccaataaggtggacttggttcacctccgcaaaatcaccagcgac
caggggcaggaaatggctgccaaacacaatatcacatacattgagacaagtgccaaggat
ccccctatgaatgtggacaaggcgtttcatgaactagtcagggttataaggcagcagatc
ccagagaggagcctgaagaagaagaagaagatgaagtggcgaggagaacgatctacgggt
tctcacaaagtccactgtgtcatcttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245216
Entry
112245216         CDS       T05605                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112245216
   04012 ErbB signaling pathway
    112245216
   04370 VEGF signaling pathway
    112245216
   04371 Apelin signaling pathway
    112245216
   04068 FoxO signaling pathway
    112245216
   04150 mTOR signaling pathway
    112245216
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112245216
   04140 Autophagy - animal
    112245216
   04137 Mitophagy - animal
    112245216
  09143 Cell growth and death
   04210 Apoptosis
    112245216
   04218 Cellular senescence
    112245216
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245216
   04540 Gap junction
    112245216
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245216
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112245216
  09152 Endocrine system
   04910 Insulin signaling pathway
    112245216
   04912 GnRH signaling pathway
    112245216
   04916 Melanogenesis
    112245216
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112245216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112245216
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112245216
   04031 GTP-binding proteins [BR:otw04031]
    112245216
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112245216
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112245216
  Exosomal proteins of colorectal cancer cells
   112245216
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112245216
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin AAA_25
Other DBs
NCBI-GeneID: 112245216
NCBI-ProteinID: XP_024268982
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc
atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc
aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc
ccggcgtgtaccgtggacacgcggcaagcccaggaactggcccgcagctatggaattccc
tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc
agagagatcaggcaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac
tgcatgagctgccgctgtgtggtgtcttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246677
Entry
112246677         CDS       T05605                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112246677
   04371 Apelin signaling pathway
    112246677
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112246677
   04137 Mitophagy - animal
    112246677
  09143 Cell growth and death
   04218 Cellular senescence
    112246677
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112246677
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112246677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112246677
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112246677
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin MMR_HSR1 Gtr1_RagA ATP_bind_1 FeoB_N AAA_16 AAA_24
Other DBs
NCBI-GeneID: 112246677
NCBI-ProteinID: XP_024270929
LinkDB
Position
Unknown
AA seq 209 aa
MATSSAVPSDNLLTYKLVVVGDGGVGKSALTIQFFQKIFVSDYDPTIEDSYLKHTEIDGQ
WAILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAF
PMVLVANKVDLVHLRKITSDQGQEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIRQQI
PERSLKKKKKMKWRGERSTGSHKVHCVIL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcaaccagcagcgcggtgcctagcgacaacctcctcacgtacaagctggtggtggtg
ggggatggtggagtggggaagagcgcgctcaccatccagttttttcagaagatctttgtg
tctgactatgaccccaccatcgaggactcctacctgaaacacacagagatagatggacag
tgggccatcctggacgtgctggatacagcaggccaagaggagttcagtgctatgagggag
cagtacatgaggacgggggatggcttcctcatcgtgttctctgtgacagacaaggccagc
tttgaacatgtggaccgcttccaccagctcatcctcagggtcaaagacagggaggccttc
cccatggtgctggtggccaataaggtggacttggttcacctccgcaaaatcaccagcgac
caggggcaggaaatggctgccaaacacaatatcacatacattgagacaagtgccaaggat
ccccctatgaatgtggacaaggcgtttcatgaactagtcagggttataaggcagcagatc
ccagagaggagcctgaagaagaagaagaagatgaagtggcgaggagaacgatctacgggt
tctcacaaagtccactgtgtcatcttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249307
Entry
112249307         CDS       T05605                                 

Definition
(RefSeq) ras-related protein R-Ras2
  KO
K07830  Ras-related protein R-Ras2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112249307
   04371 Apelin signaling pathway
    112249307
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112249307
   04137 Mitophagy - animal
    112249307
  09143 Cell growth and death
   04218 Cellular senescence
    112249307
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112249307
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112249307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112249307
   04031 GTP-binding proteins [BR:otw04031]
    112249307
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112249307
  Exosomal proteins of bladder cancer cells
   112249307
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112249307
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075
Other DBs
NCBI-GeneID: 112249307
NCBI-ProteinID: XP_024274899
LinkDB
Position
4
AA seq 202 aa
MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA
RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM
ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE
CPPSPEPTRKEKDKSGCHCVIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcagggtggaaggacggctcggtgcaggagaagtatcgactggttgtggttggaggt
ggtggtgtcggaaagtcagccctaactatacaatttatccagtcctactttgtcactgac
tatgatcccacgattgaagactcgtatacgaagcagtgtgtcattgacgagagggcggcc
cggcttgacatcctggacacggccggacaggaagagtttggagccatgagagaacaatac
atgaggacaggggagggcttcctgcttgtcttctcagtcactgacagaggaagctttgaa
gaaatctacaaatttcaaagacagatcctcagagtcaaagaccgggatgaatttcccatg
atccttgtaggcaataaagcagacctggagcttcagagacaggtgacccaggaggagggc
cagcagctggccagacagctcaaggtgacgtatatggaggcctcagccaaaatccgtatg
aatgtagaccaggctttccacgagctggttagagtaatcaggaaattccaggaacaggaa
tgcccgccctcgccagaacccacgcggaaagaaaaggacaagagtggctgccattgtgtg
atcgtctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252501
Entry
112252501         CDS       T05605                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252501
   04012 ErbB signaling pathway
    112252501
   04370 VEGF signaling pathway
    112252501
   04371 Apelin signaling pathway
    112252501
   04068 FoxO signaling pathway
    112252501
   04150 mTOR signaling pathway
    112252501
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252501
   04140 Autophagy - animal
    112252501
   04137 Mitophagy - animal
    112252501
  09143 Cell growth and death
   04210 Apoptosis
    112252501
   04218 Cellular senescence
    112252501
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252501
   04540 Gap junction
    112252501
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112252501
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112252501
  09152 Endocrine system
   04910 Insulin signaling pathway
    112252501
   04912 GnRH signaling pathway
    112252501
   04916 Melanogenesis
    112252501
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112252501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252501
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112252501
   04031 GTP-binding proteins [BR:otw04031]
    112252501
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112252501
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112252501
  Exosomal proteins of colorectal cancer cells
   112252501
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112252501
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin AAA_25
Other DBs
NCBI-GeneID: 112252501
NCBI-ProteinID: XP_024279532
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc
atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc
aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc
ccggcgtgtaccgtggacacgcggcaagcccaggaactggcccgcagctatggaattccc
tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc
agagagatcaggcaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac
tgcatgagctgccgctgtgtggtgtcttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252543
Entry
112252543         CDS       T05605                                 

Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252543
   04012 ErbB signaling pathway
    112252543
   04370 VEGF signaling pathway
    112252543
   04371 Apelin signaling pathway
    112252543
   04068 FoxO signaling pathway
    112252543
   04150 mTOR signaling pathway
    112252543
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112252543
   04137 Mitophagy - animal
    112252543
  09143 Cell growth and death
   04210 Apoptosis
    112252543
   04218 Cellular senescence
    112252543
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112252543
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112252543
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112252543
  09152 Endocrine system
   04910 Insulin signaling pathway
    112252543
   04912 GnRH signaling pathway
    112252543
   04914 Progesterone-mediated oocyte maturation
    112252543
   04916 Melanogenesis
    112252543
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252543
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112252543
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112252543
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112252543
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA AAA_25
Other DBs
NCBI-GeneID: 112252543
NCBI-ProteinID: XP_024279614
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC
VKLKKCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgaatacaagctggtggtggtgggggcaggaggtgtgggcaagagcgcgctcacc
atccagctcatccagaaccactttgtggatgaatatgaccccaccatcgaggactcatac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt
gtctttgccatcaacaacacaaagtccttcgaggacatccaccactatagagagcagatc
aagcgagtgaaagactcggaagacgtgcccatggtgctggtgggaaacaagtgtgacctg
ccgtcccggacggtggacaccaaacaagctcaggacttggcgcgcagctacggcatcccc
ttcatcgagacctcggccaaaaccagacagagagtggaggatgccttttacagtctggta
cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc
gtcaagcttaaaaagtgtgttgtgatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253803
Entry
112253803         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112253803
   04371 Apelin signaling pathway
    112253803
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112253803
   04137 Mitophagy - animal
    112253803
  09143 Cell growth and death
   04218 Cellular senescence
    112253803
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112253803
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112253803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112253803
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112253803
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16
Other DBs
NCBI-GeneID: 112253803
NCBI-ProteinID: XP_024281567
LinkDB
Position
7
AA seq 208 aa
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDAQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLLHLRKIPSDQGREMASKHSIAYIETSAKDPAMNVDKAFHELVRVIRQQIP
EXSLKKKRKTKWRADRSTVSHRLHCVVL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcaacgagcgctgttcccagtgacaatctccccacgtataagctggtagtggtgggg
gatgggggagtggggaagagtgctctcaccattcagttctttcagaagatctttgtccct
gattacgaccccaccatcgaggactcctacctcaaacacactgagattgatgcccagtgg
gccatattggacgttctggatacagcaggccaagaggagttcagtgccatgagggaacag
tacatgaggactggggacgggttcctcatcgtgttctctgtcacagacaaggccagcttt
gaacatgtggaccgcttccatcaactcatcctcagggtgaaggaccgggaatcctttcct
atggttcttgtggccaacaaagtggatctgctgcacttacgtaaaatacccagtgatcag
gggagggagatggctagtaaacacagtatagcttacattgaaaccagtgctaaggaccca
gccatgaatgttgacaaggcgttccacgagttagttagagtaatcaggcaacagattcca
gaanggagcctgaagaagaagaggaaaaccaagtggcgagccgacaggtccactgtctcc
caccgactgcactgtgttgtcctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253878
Entry
112253878         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112253878
   04371 Apelin signaling pathway
    112253878
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112253878
   04137 Mitophagy - animal
    112253878
  09143 Cell growth and death
   04218 Cellular senescence
    112253878
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112253878
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112253878
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:otw04031]
    112253878
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112253878
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16
Other DBs
NCBI-GeneID: 112253878
NCBI-ProteinID: XP_024281708
LinkDB
Position
7
AA seq 208 aa
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDAQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLLHLRKIPSDQGREMASKHSIAYIETSAKDPAMNVDKAFHELVRVIRQQIP
EXSLKKKRKTKWRADRSTVSHRLHCVVL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcaacgagcgctgttcccagtgacaatctccccacgtataagctggtagtggtgggg
gatgggggagtggggaagagtgctctcaccattcagttctttcagaagatctttgtccct
gattacgaccccaccatcgaggactcctacctcaaacacactgagattgatgcccagtgg
gccatattggacgttctggatacagcaggccaagaggagttcagtgccatgagggaacag
tacatgaggactggggacgggttcctcatcgtgttctctgtcacagacaaggccagcttt
gaacatgtggaccgcttccatcaactcatcctcagggtgaaggaccgggaatcctttcct
atggttcttgtggccaacaaagtggatctgctgcacttacgtaaaatacccagtgatcag
gggagggagatggctagtaaacacagtatagcttacattgaaaccagtgctaaggaccca
gccatgaatgttgacaaggcgttccacgagttagttagagtaatcaggcaacagattcca
gaanggagcctgaagaagaagaggaaaaccaagtggcgagccgacaggtccactgtctcc
caccgactgcactgtgttgtcctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261637
Entry
112261637         CDS       T05605                                 

Definition
(RefSeq) ras-related protein R-Ras-like
  KO
K07830  Ras-related protein R-Ras2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112261637
   04371 Apelin signaling pathway
    112261637
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112261637
   04137 Mitophagy - animal
    112261637
  09143 Cell growth and death
   04218 Cellular senescence
    112261637
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112261637
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112261637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112261637
   04031 GTP-binding proteins [BR:otw04031]
    112261637
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112261637
  Exosomal proteins of bladder cancer cells
   112261637
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112261637
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1
Other DBs
NCBI-GeneID: 112261637
NCBI-ProteinID: XP_024292886
LinkDB
Position
1
AA seq 197 aa
MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL
DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN
KADLDQSRAISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP
ANHTGKRKSGGCPCTLL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggcggtgtggggaaa
agcgccttgaccatacaattcattcagtcatactttgtatcggattatgaccccaccatc
gaggactcctacaccaaaatatgcacagtggatgggaaagagacacgattagacatcttg
gacacagcaggtcaggaggaatttggggcaatgagggagcagtacatgcgctcaggggaa
ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc
cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac
aaggctgacctggaccagtcgagagcgatctccagagaggaggcccagggctttgccaga
gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagatgaagcc
ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct
gcaaaccacacaggaaaacggaagagcggtggctgcccctgcaccctcctttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261648
Entry
112261648         CDS       T05605                                 

Definition
(RefSeq) ras-related protein R-Ras-like
  KO
K07830  Ras-related protein R-Ras2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112261648
   04371 Apelin signaling pathway
    112261648
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112261648
   04137 Mitophagy - animal
    112261648
  09143 Cell growth and death
   04218 Cellular senescence
    112261648
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112261648
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112261648
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112261648
   04031 GTP-binding proteins [BR:otw04031]
    112261648
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112261648
  Exosomal proteins of bladder cancer cells
   112261648
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112261648
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1
Other DBs
NCBI-GeneID: 112261648
NCBI-ProteinID: XP_024292907
LinkDB
Position
1
AA seq 197 aa
MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL
DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN
KADLDQSRVISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP
ANHTGKRKSDGCPCTLL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtctgctgaggaggagagattcaagctggtcgtcgtgggcgggggcggtgtggggaaa
agtgccttgaccatacaattcattcagtcatactttgtatcggattatgacccaaccatc
gaggactcctacaccaaaatatgcacagtggatgggaaagagacacgattagacatcttg
gacacagcaggtcaagaggagtttggggcaatgagggagcagtacatgcgctcaggagaa
ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc
cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac
aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga
gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc
ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct
gcaaaccacacaggaaaacggaagagcgatggctgcccctgcaccctcctttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263826
Entry
112263826         CDS       T05605                                 

Definition
(RefSeq) ras-related protein R-Ras2
  KO
K07830  Ras-related protein R-Ras2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112263826
   04371 Apelin signaling pathway
    112263826
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112263826
   04137 Mitophagy - animal
    112263826
  09143 Cell growth and death
   04218 Cellular senescence
    112263826
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112263826
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112263826
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112263826
   04031 GTP-binding proteins [BR:otw04031]
    112263826
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112263826
  Exosomal proteins of bladder cancer cells
   112263826
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112263826
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075
Other DBs
NCBI-GeneID: 112263826
NCBI-ProteinID: XP_024296213
LinkDB
Position
12
AA seq 202 aa
MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA
RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM
ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE
CPPSPEPTRKEKDKSGCHCVIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcagggtggaaggacggctcggtgcaggagaagtatcgactggttgtggttggaggt
ggtggtgtcggaaagtcagccctaactatacaatttatccagtcctactttgtcactgac
tatgatcccacgattgaagactcgtatacgaagcagtgtgtcattgacgagagggcggcc
cggcttgacatcctggacacggccggacaggaagagtttggagccatgagagaacaatac
atgaggacaggggagggcttcctgcttgtcttctcagtcactgacagaggaagctttgaa
gaaatctacaaattccaaagacagatcctcagagtcaaagaccgtgatgaatttcccatg
atccttgtaggcaataaagccgatctggagctccagagacaggtgacccaggaggagggc
cagcagctggccagacagctcaaggtgacgtatatggaggcctcagccaaaatccgtatg
aatgtagaccaggctttccacgagctggttagagtaatcaggaaattccaggaacaggaa
tgcccaccctcgccagaacccacgcggaaagaaaaggacaagagtggctgccattgtgtg
atcgtctga

DBGET integrated database retrieval system