KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218668
Entry
112218668         CDS       T05605                                 

Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218668
   04012 ErbB signaling pathway
    112218668
   04370 VEGF signaling pathway
    112218668
   04371 Apelin signaling pathway
    112218668
   04068 FoxO signaling pathway
    112218668
   04150 mTOR signaling pathway
    112218668
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218668
   04140 Autophagy - animal
    112218668
   04137 Mitophagy - animal
    112218668
  09143 Cell growth and death
   04210 Apoptosis
    112218668
   04218 Cellular senescence
    112218668
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218668
   04540 Gap junction
    112218668
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112218668
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112218668
  09152 Endocrine system
   04910 Insulin signaling pathway
    112218668
   04912 GnRH signaling pathway
    112218668
   04916 Melanogenesis
    112218668
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112218668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112218668
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112218668
   04031 GTP-binding proteins [BR:otw04031]
    112218668
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112218668
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112218668
  Exosomal proteins of colorectal cancer cells
   112218668
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112218668
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin AAA_25
Other DBs
NCBI-GeneID: 112218668
NCBI-ProteinID: XP_024235436
LinkDB
Position
19
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc
atccagctcatccagaaccactttgtggatgaatacgaccctaccatagaggactcatac
aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatt
aagcgtgtgaaagactctgacgacgtgcccatggtcctggtgggtaataaatgtgacctc
ccatcgcgtaccgtggacactcggcaagcacaggaactggcccgcagctacggaattccc
tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgctagtg
agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac
tgcatgagctgccgctgtgtggtgtcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245216
Entry
112245216         CDS       T05605                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112245216
   04012 ErbB signaling pathway
    112245216
   04370 VEGF signaling pathway
    112245216
   04371 Apelin signaling pathway
    112245216
   04068 FoxO signaling pathway
    112245216
   04150 mTOR signaling pathway
    112245216
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112245216
   04140 Autophagy - animal
    112245216
   04137 Mitophagy - animal
    112245216
  09143 Cell growth and death
   04210 Apoptosis
    112245216
   04218 Cellular senescence
    112245216
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245216
   04540 Gap junction
    112245216
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245216
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112245216
  09152 Endocrine system
   04910 Insulin signaling pathway
    112245216
   04912 GnRH signaling pathway
    112245216
   04916 Melanogenesis
    112245216
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112245216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112245216
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112245216
   04031 GTP-binding proteins [BR:otw04031]
    112245216
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112245216
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112245216
  Exosomal proteins of colorectal cancer cells
   112245216
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112245216
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin AAA_25
Other DBs
NCBI-GeneID: 112245216
NCBI-ProteinID: XP_024268982
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc
atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc
aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc
ccggcgtgtaccgtggacacgcggcaagcccaggaactggcccgcagctatggaattccc
tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc
agagagatcaggcaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac
tgcatgagctgccgctgtgtggtgtcttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252501
Entry
112252501         CDS       T05605                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252501
   04012 ErbB signaling pathway
    112252501
   04370 VEGF signaling pathway
    112252501
   04371 Apelin signaling pathway
    112252501
   04068 FoxO signaling pathway
    112252501
   04150 mTOR signaling pathway
    112252501
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252501
   04140 Autophagy - animal
    112252501
   04137 Mitophagy - animal
    112252501
  09143 Cell growth and death
   04210 Apoptosis
    112252501
   04218 Cellular senescence
    112252501
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252501
   04540 Gap junction
    112252501
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112252501
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112252501
  09152 Endocrine system
   04910 Insulin signaling pathway
    112252501
   04912 GnRH signaling pathway
    112252501
   04916 Melanogenesis
    112252501
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112252501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252501
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112252501
   04031 GTP-binding proteins [BR:otw04031]
    112252501
Membrane trafficking [BR:otw04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112252501
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112252501
  Exosomal proteins of colorectal cancer cells
   112252501
GTP-binding proteins [BR:otw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112252501
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin AAA_25
Other DBs
NCBI-GeneID: 112252501
NCBI-ProteinID: XP_024279532
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc
atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc
aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc
ccggcgtgtaccgtggacacgcggcaagcccaggaactggcccgcagctatggaattccc
tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc
agagagatcaggcaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac
tgcatgagctgccgctgtgtggtgtcttga

DBGET integrated database retrieval system