KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218682
Entry
112218682         CDS       T05605                                 

Gene name
rag2
Definition
(RefSeq) V(D)J recombination-activating protein 2
  KO
K10988  recombination-activating protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112218682 (rag2)
SSDB
Motif
Pfam: RAG2 RAG2_PHD Kelch_3
Other DBs
NCBI-GeneID: 112218682
NCBI-ProteinID: XP_024235472
LinkDB
Position
19
AA seq 533 aa
MSLQPLTAVNCSSLLQPGCSLLQLDGDIFLFGQKGWPRRSCPTGVFGVRLKHGELKLRPI
SFSNDSCYLPPLRCPAVTRLEPHDGHPEGYLIHGGRTPNNEISSSLYLLTLDSRGCNRKV
TLRCQERELVGEQPGPRYGHTLSMVQSLGKRACVVFGGRSYMPAGERSTENWNSVVDCPP
QVFIIDLEFGCCSAHTLPELTDGQSFHLALARDDYVYFLGGHTLSSDSRPPRVFCLRVEL
LQGSPLLSCKHLDTGLSISSAIATRVGPSHEYIILGGYQSETQKRMECSSVVLDDSGISI
EPREAPQWTGEISHSHTWFGGSLGEGSALIGVPSEGRPAPPEAHYFYQVCFQKEGEGEGE
DGNQGCSQESTDFEDSAPLEDSEELYFGREPHELEDSSEGEGDTYNEEDEEDETQTGYWV
KCCLGCQVDPNTWEPYYSTELLRPAMIYCSKGEGGHWVHAQCMELTEGLLVRLSQGNGKY
FCLDHGGLPHQEMTPPRQVLSLKRSPMKPQHRKGPMMPKMTPAKKRFFRRLFE
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtctctgcaaccactgactgcagtgaactgtagcagcctcctgcagcctggctgctcc
ctgttacagctggatggtgacatatttctgttcggtcagaaaggctggcccaggcgctcc
tgtcctactggggtcttcggggtacgcctaaagcatggggagctcaaactgcgacccatc
tccttctcaaatgactcctgctatcttccccctctgcgttgtcctgccgtgacccgcctt
gagccccatgatggacacccagagggctacctcattcatggaggccgaaccccaaacaac
gagatatcctccagcctctacctgctgaccctggacagccgtggctgcaaccgcaaagtg
accctgcgctgtcaggagagagagttggtgggagagcagccagggccccgatacggccac
acacttagcatggtgcagagtctgggcaagcgggcctgcgttgtgtttgggggcagatcc
tacatgccggccggggagcggagcacagagaactggaacagcgttgtggactgccctcct
caggtgttcatcatcgacttagaatttggctgctgctctgcccacaccttacctgagctc
actgacggccagtccttccacctagctttggcaagagacgactatgtctacttccttggt
ggccacactctgtcgtctgactctcgtcctcctcgtgtgttctgcctgcgtgtggagctc
ctgcagggcagccctctgctctcctgtaagcacctggacaccggcctgtccatctccagt
gctattgccacccgtgtggggccctcccatgagtacattatcctgggtgggtatcagtca
gagacccaaaagaggatggagtgcagcagtgtggtgctggatgactctgggatcagcatc
gagcccagagaggcccctcagtggacaggggaaatcagccacagccacacctggttcgga
ggcagcttgggtgaagggagcgctctgattggggtcccctctgagggcaggccagccccg
cccgaagcacattacttctaccaggtgtgcttccaaaaggagggggaaggagagggtgaa
gacgggaaccagggctgcagccaggagtccacagactttgaggactccgcccctctggag
gactctgaggagctgtacttcggccgcgagccccatgagctggaggacagcagcgaggga
gagggggatacgtacaatgaagaggatgaggaggatgagacccagacaggctattgggtc
aaatgttgcctgggctgccaggtggaccccaacacttgggagccctactactccacagaa
ctgctgcggccagccatgatctactgctccaaaggggagggaggccactgggtccatgcc
cagtgtatggagctgacagagggcctgctggtgaggctctcgcagggaaacggcaagtac
ttctgcctggaccacgggggcctgccccaccaggagatgaccccgccacgccaggtgctg
tccctgaagaggagccccatgaaaccccagcacaggaagggcccaatgatgccgaagatg
acacccgccaagaagcgcttcttcaggaggctgtttgagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218685
Entry
112218685         CDS       T05605                                 

Gene name
rag1
Definition
(RefSeq) V(D)J recombination-activating protein 1
  KO
K10628  V(D)J recombination-activating protein 1 [EC:2.3.2.27]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112218685 (rag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:otw04121]
    112218685 (rag1)
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112218685 (rag1)
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112218685 (rag1)
SSDB
Motif
Pfam: RAG1 RAG1_imp_bd zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RAG1 zf-RING_10 zf-C3HC4_4 zf-RING_UBOX zf-RING_6
Other DBs
NCBI-GeneID: 112218685
NCBI-ProteinID: XP_024235475
LinkDB
Position
19
AA seq 1078 aa
MEEGTLETYAPRCSMPAELHHPYSKFSDWKFKLFRVRSMERAPLPGEMQLERGALSGVVA
SAPLEETVGDVVGLPGSVMKLCLGGKSKENVEGPGKRVDLKLQEMDTHMNHLRCLCRLCG
GALRKAKGPEHEVQGLLDEASRSALRRMGCKATSWPEVILKVFKVDVAGDMEVVHPPFFC
QRCWTLAMRGGGFCSFSRTHVPGWRPHTTLCLLCHPKKPSLQRRGRKRRKPTRGAQRLAK
RTKWDIQDNAAIVGEKRAWRTVIDPHQGPGLRPWVRSSVQRAQWVKSITLCQKEHLSARL
LSEDLPVDFLSSVTCQVCDHLLSEPVQSPCRHLFCRSCIAKYIYSLGPHCPACTLPCGPA
DLTAPAKGFLGVLHSLPLLCPRESCGEQVRLDSFRAHCLGHHLEEVDGDHKSAENSLDNF
LPVNKGGRPRQHLLSLTRRAQKHRLRDLKTQVKVFAEKEEGGDTKSVCLTLFLLALRAGN
EHRQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTL
RAAEKELLPGYHPFEWQPALKSVSTSCHVGIIDGLSGWIASVDDSPADTVTRRFRYDVAL
VSALKDLEEDIMEGLRERGLEDSACTSGFSVMIKESCDGMGDVSEKHGGGPAVPEKAVRF
SFTIMSVSIQAEGEDEAITIFREPKPNSEMSCKPLCLMFVDESDHETLTGVLGPVVAERN
AMKHSRLILSVGGLSRSFRFHFRGTGYDEKMVREMEGLEASGSTYICTLCDSTRAEASQN
MTLHSVTRSHDENLERYELWRTNPHSESAEELRDRVKGVSAKPFMETQPTLDALHCDIGN
ATEFYKIFQDEIGEVYHKANPSREQRRSWRAALDKQLRKKMKLKPVMRMNGNYARKLMTR
EAVEAVCELVCSEERQEALRELMGLYIQMKPVWRSTCPAKECPDELCRYSFNSQRFAELL
STVFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRRFRKMNARQSK
TFELEDVLKHHWLYTSKYLQKYMEAHKDSAKALQATIDTVGSQETQEDADMSLDVPDF
NT seq 3237 nt   +upstreamnt  +downstreamnt
atggaggagggtaccctggagacatatgccccccggtgctccatgccggccgagctccat
catccctactccaagttctcagactggaagttcaagctgttccgggtcaggtccatggag
agggccccactgcccggggagatgcagctagagagaggggccttgtctggggttgtggct
tctgcacccctggaggaaactgtgggggatgtggtgggtctcccagggagtgtgatgaag
ctttgcctggggggtaagagcaaggagaacgtagagggcccgggaaagagagtggacctg
aaactccaggagatggacacacacatgaaccacctcaggtgtctgtgccgtctctgtggc
ggggccctgaggaaagccaaaggtccagagcatgaagtccaggggcttctggacgaggct
agcaggagtgccctgcgtaggatgggctgcaaggccaccagctggccagaggtcatcctc
aaggtcttcaaagtggacgtggcgggggacatggaggtcgtccatccgccattcttctgc
cagcgctgctggacattggccatgcgaggagggggcttctgcagcttctccaggacccat
gtccctgggtggagaccccacaccaccctctgcctcctctgccaccccaagaaaccctca
ctacagaggagagggaggaagaggcggaagcctactcgtggagcccaacgcctggctaag
aggaccaagtgggacatccaggataacgctgctattgttggtgagaagagagcctggaga
acagtgatagatcctcaccagggacctggacttagaccctgggtgagatccagcgtccag
agagctcagtgggtgaagagcatcaccctctgccagaaagagcaccttagtgccagactg
ctgtccgaggacctccctgtggacttcctgagctcagtcacctgtcaggtgtgtgaccac
ctgttgtctgagcccgtccagtccccctgcagacacctcttctgccgcagctgcattgct
aaatatatttactctctggggccccactgcccggcttgcaccctgccctgcggccctgcc
gaccttactgccccagctaagggcttcctgggggtcctgcactccctgccgctgctttgc
cccagagagagctgtggggagcaggtacggctggactccttcagagcccactgcttgggt
caccatctggaggaagtggatggggaccacaagtcagcggaaaatagcctggacaacttc
ctgcctgtcaacaaagggggaaggccccgacagcatctcttgtcactgacgaggcgtgcc
cagaagcaccggctgagggacctgaagacccaggtgaaggtgtttgcagagaaggaagaa
ggtggagacaccaagtcggtgtgcctgaccctgttcctgctagctttgagggctggaaac
gaacaccggcaggcagacgaactggaggccatgatgcaaggcaggggctttggcctgcat
cctgctgtgtgtctggccatccgggtcaacacgttcctgagctgcagccagtaccacaag
atgtaccgcaccgtcaaggccaccagtgggcgccagatcttccagcccctgcacacctta
cgcgctgcagagaaggagctcctcccaggctaccacccctttgagtggcagccggccctc
aagagtgtgtccacatcctgccatgtggggatcattgacgggctatcagggtggatcgct
tcggtggacgactccccagcagatacagtcacgcgacggtttcgctacgacgtggcgctg
gtgtcagccctgaaggacctggaggaggacatcatggaggggctgagagagcgaggcctg
gaggacagtgcttgcacctcgggcttcagcgttatgatcaaggagtcctgcgatggtatg
ggggacgtcagtgagaagcatggcggagggccggccgtcccggaaaaggctgtgcgtttc
tccttcaccatcatgtccgtctcaattcaagctgagggagaagatgaggcgatcaccatt
ttccgggagcccaagcccaactcagagatgtcctgcaagccactatgcctgatgtttgtg
gacgagtcggaccacgagactctcacaggtgtcctggggcctgtggtggccgaaaggaat
gctatgaagcacagccgtctcatcctgtctgtgggcggcctttctcgctccttccgcttc
cacttccggggcacgggctatgatgagaagatggtgcgagagatggagggtttggaggcc
tctggctccacttacatctgcacgctgtgtgactccactcgggcagaggcctcccaaaac
atgactctccactctgtcacccgcagccatgacgagaacctggagcgctacgaactttgg
aggaccaaccctcattctgagtcagctgaagagctgcgagaccgagtcaaaggcgtctct
gccaagcccttcatggagacccagcccacactggacgccctgcactgtgatatcggcaat
gccactgagttctacaagatcttccaggatgagataggggaggtctatcacaaggcaaac
cccagccgggagcagcgtcggagctggcgggccgccctggacaagcagctgaggaagaag
atgaagctgaagcctgtgatgaggatgaatgggaactatgcacggaagctgatgacccgg
gaggcagtggaggcagtgtgtgagctggtgtgctcagaggagcgtcaggaagccctgagg
gagctgatggggctctacatccagatgaagcctgtgtggcgctccacctgcccggccaag
gagtgcccagacgagctctgccggtatagcttcaactcccaacgcttcgcagagctgctc
tccaccgtcttcaagtacaggtatgacggaaagatcaccaactacctgcacaagaccttg
gcccatgtgccagagattgtggagagggatggctccatcggggcctgggccagcgagggg
aatgagtctgggaacaagctgttcagacggttcaggaagatgaatgcccgccagtccaag
acctttgagctggaggacgtgctgaagcaccactggctctacacatccaagtacctgcag
aagtacatggaagctcacaaggactctgccaaagctctgcaggccaccattgacactgtg
gggagtcaggagacacaggaggatgctgacatgtcactggatgtcccagacttttga

DBGET integrated database retrieval system