KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218717
Entry
112218717         CDS       T05605                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2-like
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112218717
   04020 Calcium signaling pathway
    112218717
   04070 Phosphatidylinositol signaling system
    112218717
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112218717
   04210 Apoptosis
    112218717
   04218 Cellular senescence
    112218717
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112218717
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112218717
   04625 C-type lectin receptor signaling pathway
    112218717
  09152 Endocrine system
   04912 GnRH signaling pathway
    112218717
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112218717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112218717
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112218717
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR Flu_B_M2
Other DBs
NCBI-GeneID: 112218717
NCBI-ProteinID: XP_024235539
LinkDB
Position
19
AA seq 1713 aa
MSDNRSSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVQPDAGDLANPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNNNTEEDLFKKLQHAAELEQKQNETENKKLLGEVVKYSN
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPAGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKVTLFMKFSDYREDVLKGGDV
VRLFHAEQEKFLTCDEYRNQQHIFLRTTLRQSATSATSSKALWEIEVVHYDPCRGGAGQW
NSLFRFKHLATGNYLAAEINPDFRDESVASKAEVNQTETDTAYSKRKRQAAEKIACTLVS
VPHGNDIASLFELDATTLQMADCLVPRNSYVRLRHLCTNTWVSSTNFPIDAEEERPVMLK
IGTCPTKEDKEAFAIVSVPLFEVRDLDFANDANKVLESTVKKLQYGNIAQNERRFVTKLL
EDLIFFVCEVPNNGQDVLSVVISNPNRERQKLMREQNILAQIFGILKAPFTDQGEGPMLK
LEDLGDQRYAPFKYMLQLCYRVLRHSQQDYRKNQEYIAKKFSIMQSQIGYEILAEDTITA
LLHNNRKLLEKHITAKEIETFVKLLRRNREPRFLDYLSDLCVSNKTAIPVTQELICKFML
NSANADILIQTKLIPNTETSLESSLLLEDTEEEEVWLYWIDSHKEPHGKSIRHLAQDAKG
NHKLDSDIITYYRYQLNLFAKMCLDRQYLAINRLSSQLPVELILRCMFDDCLPYNLRASF
CRLMLHMHVDREPQEAVVAVRYARLWTEIPSKITIHEYEYEFRDTSREEMKRKFAPTMEF
VEEYLKDVVSQPFPFGDKEKNELTLEVVHLARNLVYFGFYSFSELLRLTRTLLAILDFVQ
HPLTYMDKLSKSPEAGNNVLRTIHGVGEMMTQMVLSRGYVLPHHLPDTPPSLQHGIQPFL
LPDNEDVMVMDTKLKIIEILQFILSVRLDYRITYLLSIYKKEFGDRNLPDSSMSVSEFPS
MSDPDIDEIAAKAETMFAGSSECSAVELDDEGGRTFLRVLIHLIMQDYPPLVSGSLQLMF
KHFSQRAEVLQAFKQVQLLVSEQDVENYKQIKTDLDQLRLTVEKSELWVEKSGAYGSEDI
GESQGKEQTMEEAGILSPVQGGDVKPQIDSNKANNYNIVKEILLRLSKQCYPGKKSRVQQ
QRLLKNMGAHTVVLDLLQIPYEKSDKKMNEIMTLAHVFLQNFCKGNSQNQVLLHKHLNLF
LTPGLLEAETMRHIFMNNFYLCNDISDRVVHHFVHCIETHGRHVQYLKFLQTIVKADGKY
VKKCQDKVMTELVNGGEDVLVFYNDRSSFPVLFQMMCCERERGDEGGALAYHNTLVELLA
ACTEGKNVYTELKCNSLLPLDDIVKVVTHDDCIAEVKTAYVNFVNHCYVDTEVEMKEIYT
SHHIWKLFENFLVDMARVCNSTTDRNHADVPLEMYVIETVMAIVKGFFSSQFPVNNSNLQ
THQPIFIKLLQSSFRIYNCTWISSAQKNNIEGCIKTLADVAKARAIAIPVDLDSQVNTLS
LKAHTNVVHRAAKDWRISARTRPRKETLGGPDYKSIIEKLQGVVACLEEQFSPKVQAEFS
VLVDVLHSPELLFPEAARLRCESGAFMSKLIKHTKKLMDKEEKLCIKILQTLREMLDKKE
AFDEPVSTDPDMVRQEFVYIQGIFGIGMCRTSI
NT seq 5142 nt   +upstreamnt  +downstreamnt
atgtcagacaacagatcaagttttcttcatattggagacattgtgtcgctgtacgcagaa
ggcactgtcaatggcttcatcagtacattggggcttgttgatgacaggtgtgtggtgcag
cccgatgcaggagacctggccaatccgcccaaaaagttcagagactgcctgttcaaggtg
tgtccgatgaacagatactcagctcagaagcagttctggaaggccaaacagggcaaacaa
ggcaacaacaacacagaagaagacctattcaagaagttacagcatgcagcagaactggaa
cagaagcagaatgagacggagaataagaagctgctgggagaggtggtaaagtacagtaac
gtcatccagcttctgcatataaagagtaacaagtacttgacggtgaacaagcgtctgcca
gcgctgctggagaagaacgccatgcgtgtgtctctggacccagctggcaatgagggctcc
tggttctacatccagcccttctggaaactccgcagcgagggggataacgtggtggtggga
gacaaagtggtcctgatgcccgtgaacgcagggcagcctctccacgccagcaacattgag
ctgctagacaaccctggctgcaaggaggtgaacgctgtgaactgcaacaccagctggaag
gtcactctgttcatgaagttcagtgactacagagaggacgtcctcaaaggaggtgatgtg
gtgcgtctgttccacgctgaacaagagaagttcttgacatgtgacgaatacaggaatcag
cagcacatcttcctcaggaccaccctgagacagtctgccacctctgccaccagctccaaa
gcactctgggaaatagaggttgtgcactacgacccctgcagagggggtgccggccaatgg
aacagcctgtttcgcttcaaacacctggccactggaaactacctggctgcagagattaac
cctgatttccgtgatgaaagtgtggcatctaaagcagaggtgaatcagacggagacagat
acagcgtactccaagaggaagcgtcaggctgcagagaagatagcctgcaccctggtgtct
gtgccccatggcaacgacatcgcttctctgtttgagctggacgccaccacgctgcagatg
gctgactgtctggtgcccaggaactcatacgtacggctgagacacctatgtaccaacacc
tgggtgagcagcaccaacttccccatcgacgctgaggaggagcgccccgtcatgctcaag
attggcacgtgccctacgaaggaggacaaggaggcatttgctattgtctctgtacctctg
tttgaggtccgagacctggactttgccaacgatgccaacaaggtcctggagtcgaccgtg
aagaagctgcagtatggcaacattgctcagaacgagaggaggtttgtgaccaagctgttg
gaggacctgatcttctttgtgtgcgaggtccccaacaacggtcaggacgtgctgtctgtg
gtcatctccaaccccaacagggaaaggcagaaactaatgagggaacagaacattctagcc
cagatttttggtattctgaaggctccattcacagaccagggggagggtcccatgctgaag
ctggaggacttgggggaccagcgctacgctccctttaagtacatgctgcagctgtgctat
cgggtgctgcgccactcccaacaggactaccgcaagaaccaggagtacatagccaagaag
ttctccatcatgcagtctcagatcggttatgagatcctggcggaggacacaattacagct
ctgctccacaacaaccgcaagctgctggagaaacacatcacagccaaggagattgagacc
ttcgtcaaactgctgcgtcgcaatcgagagcccaggttcctggactatctgtcagacctg
tgtgtgtccaataagacggccattccagtgacacaggagcttatctgtaaattcatgctg
aactccgccaatgctgacatcctcatccagaccaagctaatccccaacacagagacatcc
ctggagtcgtccttgctgctggaggacacagaggaggaggaggtgtggctctactggatc
gacagccacaaggagccgcacggcaagtccatccgccacctggcccaggacgccaagggc
aaccacaagctggacagtgacatcatcacctactacagataccagctcaacctttttgcc
aagatgtgtctggaccgccagtacctggccatcaaccggttgtccagccagctgcccgtg
gaactgatcctgcgctgcatgtttgacgactgcctgccctacaacctgcgtgcctctttc
tgccgcctcatgctgcacatgcacgtggaccgcgagccccaggaagccgtggtggctgtg
cgctacgcccgcctctggaccgagatcccctccaagatcaccatccacgagtatgagtat
gagttcagagacacctccagagaggagatgaagaggaagtttgcccccaccatggagttt
gtagaggaatacctcaaagacgtggtcagccaaccctttcccttcggagataaagagaag
aatgaattgactctggaggtggtacatctggcccgtaacctggtctactttggcttctac
agcttcagtgagctgctgcgtctcacacgtaccctcctggccatactggactttgtccag
cacccactcacctacatggacaagctcagcaagagtcccgaggcaggaaacaacgtgttg
cgtaccatccacggcgtgggggagatgatgacacagatggtgctgagtagagggtacgtc
ctgcctcaccacctccccgacacgcccccgtccctccagcacggaatacagcctttcctt
ctgcctgacaacgaggacgtcatggtcatggataccaagctcaaaatcattgagatctta
cagttcatcctgagtgtgcggctggattacaggatcacctacttgctatccatctataag
aaagaatttggggacaggaatctaccagacagctctatgtcggtgtctgaattcccttcc
atgtcagatccagacatagatgagattgcagccaaagcagagaccatgtttgctggaagt
tcagagtgtagtgctgtggagctggatgacgaagggggtaggaccttcctgagggtgctg
atccacctcatcatgcaggactaccccccactggtctcaggctcactgcagctcatgttc
aaacacttcagccagagagcagaggtcctacaggccttcaaacaggtccagttgctggtg
tcggagcaggatgtagagaactacaagcagatcaagacagacctggaccagctaaggctg
acagtggagaagtctgaactgtgggtggagaaaagtggagcctacggcagtgaggacata
ggagagagtcagggcaaggagcagaccatggaggaggctggaatcctgagcccagtacag
ggcggggatgtgaagccacagatagacagcaacaaagccaacaactacaacattgtcaaa
gagatcctgctgcggctcagtaagcagtgttaccccggtaaaaagagtcgtgtgcagcag
cagaggttactgaagaacatgggcgctcacactgtggtgctggacctgctccagatacct
tatgagaagagtgataagaagatgaatgagatcatgacactggcccacgtgttcctgcag
aacttctgtaaagggaacagccagaatcaggttctgctccacaaacacctcaacctgttc
ctcacaccagggctcctggaggctgagaccatgcgccacatcttcatgaacaacttctat
ctgtgcaacgatatcagtgaccgtgtggtccaccattttgttcactgcatcgagacgcac
ggccgacacgtccagtacctcaagttcctccagaccatcgtcaaggccgacgggaagtat
gtcaagaagtgccaggacaaggtcatgaccgagctggtgaacggtggcgaggacgtgctg
gtgttctacaacgaccgctcctccttcccggtgctgttccagatgatgtgctgcgagcgg
gagcgtggggacgagggcggagccctggcctaccacaacaccctggtagagctcctcgct
gcctgcacagagggcaaaaacgtctacaccgagctgaaatgcaactccctgcttcccctg
gacgacatcgtcaaggtggtcacccacgatgactgcatcgctgaggtgaagacggcctac
gtgaactttgtgaaccactgctatgtggacacggaggtggagatgaaggagatctacacc
agccaccacatctggaagctctttgagaactttttggtggacatggcacgggtgtgcaac
agcaccacggaccgtaaccatgccgacgttcccctggaaatgtatgtgattgagacagta
atggccatcgtcaagggcttcttcagctcccagttccctgtcaacaactccaacctgcag
actcaccagcccatcttcatcaagctgctccagtcttccttcaggatctataactgcacc
tggatcagctcagcccagaagaacaacattgagggctgcatcaaaacactggctgacgtg
gccaaggcgcgtgccatagccataccagtggatctggacagccaggtgaacactctgtct
ctgaaggcccacaccaatgtggtgcatcgtgccgccaaggactggaggatctcagcacgc
acccggccccgaaaggagaccctaggagggcccgactacaagagcatcattgagaagctg
cagggtgtggtggcatgtctagaggagcagttcagtcctaaggtgcaggccgagttctct
gtgttggtggatgtactacacagccctgagctgttgttcccagaggctgccaggctgcgc
tgtgagagtggagccttcatgtccaaactgatcaaacacaccaagaagctgatggacaaa
gaggaaaaactgtgtattaagatcctgcagacacttagagaaatgctggataagaaggag
gccttcgatgagcctgtgagtactgatccagacatggtgagacaagagtttgtttatata
caaggtatttttggtatagggatgtgcagaacatcaatatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221364
Entry
112221364         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 3-like
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112221364
   04020 Calcium signaling pathway
    112221364
   04070 Phosphatidylinositol signaling system
    112221364
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112221364
   04210 Apoptosis
    112221364
   04218 Cellular senescence
    112221364
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112221364
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112221364
   04625 C-type lectin receptor signaling pathway
    112221364
  09152 Endocrine system
   04912 GnRH signaling pathway
    112221364
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112221364
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112221364
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112221364
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112221364
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112221364
SSDB
Motif
Pfam: Ins145_P3_rec MIR RIH_assoc Ion_trans RYDR_ITPR
Other DBs
NCBI-GeneID: 112221364
NCBI-ProteinID: XP_024239285
LinkDB
Position
22
AA seq 2395 aa
MSDSMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQAKHEKDKIADVVLLQKLQHASNLEQKQNETENKKVHGDVVKYG
TVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWMFIQPFWKLRANGDNVVV
GDKVILNPVNAGQPLHASNYELSDHTGCKEVNSVNSNTSWKINLFMMFSDHKDEVLKGGD
VVRLFHAEQEKFLTCDEYKVKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGH
WNSLYRFKHLATGNYLAAEENPGYKGDGVEIQTSVIDDTQDTRRKLKMLGERIKYKLSAM
PHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLML
GTCPTKEDKEAFAIVSVPVMEIRDLDFANDASFMLSTVVDRFNEGFISLNDRRFAIKRLR
IGWSLWWDQPQAVRLCRVVHDQGQNRERQKLMREQNILKTAREGNQKLAQEARQGNHHDE
NVLRYYRYQLKLYARICLDRQYLAIGEISKQLDVELIFLCMMDETLPFDLRASFCRLMLH
THVDRDPQELVTPVKFARLWTEIPTSITIKDYDSNMDDLRDNKKNKFANTMVFMEEYLNN
VLNDDLPFADEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCIPNPSLHPV
LQDDGSGRNMKRSIHSVGQMMSTMVLTRKQSMFGGPGRSVSIIEGPNRSKDSIGKQDITV
MDTKLKILEILQFILNVRLDYRLSFLLSVFKKEFVDVYPMADADATTSMEQAATINLQHI
GDQAEAMFGVGKGNSILEVDDEGGRMFLRVLIHLTMHDYPPLVSGALQLLFKHFSQRQEV
LHTFKQVQLLISGQDVDNYKLIKSDLDLLRTMVEKSELWVDKKSGSGGGEGKKDKNENVE
MDLEDVTLKKEQLDKSNENYRKSERSWILMEAETVQHIFSNNYQLCTEISENVLQHFVHC
LATHGRHVQYLNFLHTIIKAEGKYVKKCQDMIMTELTNAGEDVVVFYNDKASFSTMLELM
AESREGVQEHSPLRYHISLVELLSACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEV
KVAYVNFVNHCYVDTEVEMKEIYTSNHIWKLFEDFIVDMARVCNKREKRLTDPILEKYII
NVVFDTINTFFSSPFSENSTSLQTHHTTVTQLLQSSMRLLECPWLQQQHRGLVETCIRTL
ALTAKNRSISLPLDLESQITTMLSSSSLNSLSRSNPNYKSSTRSSRPSAPNNPWDYKNII
EKLQDIIGTLEQRLKPLLNAELSVLVDVLQQPELLFLEGTDARQCCESGGFISKLIQHTK
ALMNSDEKLCIKVLRILQEMLIRTLDFDEKGIALRKVLLQNYLFTNKKNNKAELVELGAT
GAEQERDWVAVAAIQCHLDREGGTKLFTDLIMSTKNNKIFQESIQMAICLMEGGNTEIQN
SFYKLMMGDNKSEKFFKVLHDRMINAQMDIKANVSVSVGEMTNKDLQTGSDGSVLPGSVV
PASESDQQETEMGPAVIIMKPILRFLQLLCENHNQDLQNFLRCQNNKTNYNLVCETLQFL
DVMCGSTTGGLGLLGLYINESNVVLITQTLETLTEYCQGPCHENQTCIVAHESNGIDIIT
ALILNDISPLCCYRMEMVLQLKDNASKLLLALMESRHDNENAERILFNLRPRELVEVIKK
AYQQESECEVGVVSPQEVGHNIYILALQLARHNKILLNLLKPAKRTEAGEEGISSMVSVS
RSRFITFVCSFFVAFLTCVYFKVCSFVQGFSVSGFLINWRKLSCERPPFTLPLRLCYSCS
HQCVNSEHETSLSQMLKYTVPLCVRTASMEQIVSPIHPICEFLMEESKFRVFNTTEQERA
EAARMSTWGSISFNLAVSSTSSSVFLPLRLRPRILILWYGLRPFIRGPILRSIYHFGIGP
TLTYWNPQWFIVFLLHPRLNKIVFVVSFVGNNGTFIMGYRAMVMDVEFLYHLAYVLTSTL
GLCVHELFYSFLLFDLIYREETLFNVIKSVTRNGRSILLTALLAIILVYLFSIVGFLCLK
NDFIMEVDPLPQITSGRHGNEEASQDFLNTCSKDGVSCTAKAGLPAEPEAEENNSERACD
TLLMCIVTVLNHGLRNGGGVGDVLRRPSKNEPLFPARVIYDLLFYFIVIIIVLNLIFGVI
IDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVLVR
EKNKTDYTGPESYVALMIKSKNLDWFPRMQAMSLVVTDGDGDQNEMRNLQDRLTSTMNVV
SQLTGQLTELKEQMTDQRKRRQRMGFVDVQSGGGAGAASMSPSVAGGNHLMSNKP
NT seq 7188 nt   +upstreamnt  +downstreamnt
atgtcggattcaatgtccagctttttgcacattggggacatcgtttccctttacgcggag
ggctctgtcaatggttttataagtactcttgggttagtggatgacagatgtgtggtagag
ccagctgcaggggacctggacaatccccccaagaagttcagagactgcctcttcaaagtg
tgtcccatgaaccgctactctgcacagaaacagttctggaaagccaagcaggccaagcat
gagaaggacaagattgctgatgtggtgctacttcagaaactacagcatgcctctaatctg
gagcaaaaacagaacgagaccgaaaacaagaaggtccatggcgatgtagtaaaatacggc
actgtcattcagcttctgcatatgaagagtaataaatacctgactgtgaataagcgtctg
cctgccctgctggagaagaatgccatgcgggtcaccctggacgggacggggaatgagggc
tcctggatgttcatccaacccttctggaagctaagggccaacggagacaatgtagtggtg
ggagacaaggtgatcctgaacccagtgaatgcaggccagcccctacacgccagcaactat
gagctctccgaccacactggatgcaaagaggtgaactctgtgaacagcaacactagctgg
aagatcaacctgttcatgatgttcagtgaccataaggatgaggtcttgaaaggaggggat
gtggtgcggttgttccatgcggagcaggagaagttcctgacctgtgacgagtacaaggtc
aagctgcatgtgttcctccgtaccaccctgcgccagtctgctacctctgccaccagctcc
aatgccctgtgggaagtggaggtggtgcaccatgacccatgtcgaggaggggccggacac
tggaacagtctgtaccgctttaaacaccttgccacagggaactatcttgcagctgaggaa
aatccgggttacaaaggggacggcgttgaaatccagacgtcggtgatcgacgatacgcag
gacactagaagaaaactgaagatgttgggcgagaggatcaagtacaagctgtcggctatg
ccacatgggaatgacattgcctctttgtttgagctagaccccacaactctgcagaaaaca
gactcctttgtgccaaggaattcgtatgtgcgcctcagacacctatgcaccaacacgtgg
atacagagtaccaacgtgcccatagatatagatgaggagagacctattagactcatgctg
ggcacctgtcctaccaaagaggataaggaggcttttgccatcgtgtcagtgccagtgatg
gagatccgggacctggactttgccaacgatgccagtttcatgttgagcaccgtagtggac
aggtttaacgagggatttatcagcctcaatgacagaaggtttgccattaagcggctaagg
atcgggtggtctttgtggtgggaccagccacaagcggtcaggttgtgcagagtggtgcat
gaccaaggtcaaaaccgagagagacagaaactcatgagggaacaaaacatcctcaaaaca
gcaagagaaggcaatcagaaactagcccaggaggccagacaggggaaccaccatgacgag
aatgtgctcagatactataggtaccagctaaagctgtatgctcggatatgtctggaccgc
cagtacctggccataggtgagatctctaagcagctggatgtggaactcatcttcctgtgt
atgatggacgagacgctgccctttgacctcagagcctccttctgcagactcatgctgcac
acgcacgtcgaccgagaccctcaggagctggtgacccctgtcaagtttgcacgtctgtgg
acagagatcccaacctccatcacaattaaagattatgattccaacatggatgacttgcgg
gacaataagaagaacaagtttgccaacaccatggtgttcatggaggagtacctcaacaac
gtcctcaatgacgacttacccttcgctgacgaggaaaagaacaaactcacctatgaggtg
gtgagcctggccagacacctcatctacttcggcttctacagtttctttgagctgctgagg
ttgacacgcactcttctgggaatcattgactgtattcccaacccttcccttcaccctgtg
ctccaggacgatggcagtggaaggaacatgaagcgttccatccatagcgtgggtcagatg
atgtccaccatggtactgaccaggaaacagtccatgtttggaggtccagggaggagtgtt
tccattatagaaggaccgaaccgcagcaaggacagcatcggcaaacaggacatcaccgtc
atggacaccaagttgaaaatactggaaatcctgcagtttatcctgaatgtccgcctggac
taccggctctccttcctgctgtctgtcttcaagaaggagtttgttgatgtttatcccatg
gcagatgccgatgctacaacatcaatggagcaagcagccaccatcaacctgcagcacata
ggagatcaggcagaggccatgtttggtgtggggaaggggaacagcatactagaggtggat
gatgagggaggtcgaatgttcttgagggtgttgatccacctcaccatgcatgattaccct
ccactggtgtctggggccctccagctgctcttcaagcacttcagccagagacaggaggtg
ctgcacacctttaaacaggtccagttgttgatctcggggcaggatgttgataactacaag
ctgataaagagtgaccttgaccttctccgcaccatggtggagaagtctgagctctgggtg
gacaagaagagcggctctggaggaggggaggggaagaaggacaaaaatgaaaatgtagag
atggacttagaggatgtgaccctgaagaaagagcagttggataagagcaatgagaactac
agaaagtcagagagatcatggatcctcatggaggctgaaacggttcagcacatcttcagt
aataactaccaactgtgtacagagatcagtgagaacgtgctgcagcacttcgtccactgc
ctggccactcacggacgccacgtccagtacctcaacttcctgcacaccatcatcaaggcc
gaggggaagtatgtgaagaagtgtcaggacatgattatgactgagttaaccaacgccggt
gaggatgtggtggtgttttataatgacaaggcgtcattttccaccatgctggagctgatg
gcagagtccagggagggggttcaggagcacagccccctgcgctaccacatctctctggtg
gagctgctatctgcctgcgctgagggcaagaacgtttacacagagatcaaatgtacctcg
ctgctgcccctagaggacgtggtgagagtggtcacacacgaggactgtatcacagaggtg
aaggttgcctatgtgaactttgtgaaccactgctacgtagacacagaggtagagatgaag
gagatttacaccagcaaccacatctggaaactgtttgaggacttcatcgtggacatggcc
agggtgtgtaacaagagagagaagcgtctgactgaccccatcctggagaagtacatcatc
aacgtggtgtttgacaccatcaataccttcttcagctcccccttctctgaaaacagcacc
tctctacagactcaccacaccacagtaacgcagctgctccagtctagcatgcgtctgctg
gaatgtccctggctgcagcagcaacacagaggcctggtggagacctgcatccgtaccctg
gctctgacagcgaagaaccgctccatatccctgcctctggacctggagtctcagatcacc
accatgctgagcagcagttccctcaactctctgtcccgctccaaccccaactacaagagc
tccacccgctccagccgcccctccgcccccaacaacccctgggactacaagaacatcatt
gagaagctgcaggacatcatcgggactctggagcagcgtctgaagccgctgttgaacgca
gagctgtctgttctggtggatgtcctgcagcaacctgaactcctcttcctggagggaacg
gatgcacggcaatgctgcgaatcaggaggcttcatctcaaaactgattcagcacactaaa
gccctgatgaactccgacgagaagctctgtatcaaggttctgaggattctgcaggagatg
ctcatacgtacactggactttgacgagaaggggattgcactgaggaaggtgctgctacag
aactacctgttcaccaacaagaagaacaacaaggcagagctggttgaacttggagcaaca
ggtgctgagcaggaaagggactgggtggctgtagctgctattcagtgtcatctggacagg
gagggtgggactaagctcttcaccgacctcataatgagtaccaagaacaacaagattttc
caggagagcatccagatggccatatgtctgatggaggggggcaacacagagatacagaac
tccttctacaagctgatgatgggggacaacaagtcagagaaattcttcaaggtcctccac
gaccggatgataaacgctcagatggacatcaaggccaacgtatcagtcagcgtgggagag
atgactaacaaagaccttcagactggctctgatgggtcggttctacctggctctgttgtc
ccggcctctgagtctgatcagcaagagacagagatgggccctgcagttatcatcatgaaa
cccatcctacgcttcctccagctgctctgtgagaatcacaaccaggacctacagaacttc
ctgcgctgccagaacaacaagaccaactacaacctggtgtgtgagacactgcagtttctg
gatgtcatgtgtggcagcaccacaggaggcctgggcctgctgggcctctacattaacgag
agcaacgtggtcctcatcacccagaccctggagacgctcacagagtactgccagggcccc
tgccacgagaaccagacctgtatagtggcccatgagtccaacggcatcgacatcatcaca
gccctcatactgaatgacatcagtcctctgtgttgttaccgcatggagatggtgctgcag
ctcaaggacaacgcctccaagctgctgctggctctgatggagagtcgccatgacaacgag
aatgcagagaggatactgtttaacctccgacctcgggaactggtagaggtgataaagaaa
gcctatcagcaggagagtgagtgtgaagttggagtggtgtcacctcaagaggtcggccac
aacatttacatcctggcacttcagctggcgaggcacaataagatcctgctcaatctgctg
aaacctgcaaagaggaccgaagcaggagaggagggtatatcctctatggtcagtgtttct
cgctctcgtttcatcacgtttgtctgttcattctttgtagcctttctaacgtgtgtttat
tttaaagtctgttcgtttgtacaaggtttcagtgtatctggttttcttattaattggagg
aagttgtcctgtgaacggcctcccttcacattacctctacgtctatgctacagctgctcg
catcaatgcgtgaactctgaacacgagacctctctctctcagatgttgaaatatacggtg
ccattgtgcgtgaggaccgccagcatggagcagatcgtgtcccccattcatcccatctgt
gagttcctgatggaggagtccaagttccgtgtgttcaacaccactgagcaggaacgagca
gaggcagcaaggatgagcacctggggcagcatctcctttaacctggccgtctcatcaacc
tcatcatccgtttttctacccctacgactcaggccaagaatcctcatcctgtggtacggc
ctcaggccctttatccgtggccctatactgcgctccatctaccactttggcatcggtccc
actctcacctactggaaccctcaatggttcatcgtgttcctcctccacccacgcttaaat
aagatagtgtttgtggtgagctttgtgggcaacaacgggacatttatcatgggctaccgt
gcgatggtgatggacgtggagttcctgtatcacctggcctacgttctgaccagcaccctg
ggcctctgtgtccacgagctgttctacagcttcctgctgtttgatctgatctaccgagag
gagacgctgttcaacgtgataaagagtgtgactcggaatgggcgctccatcctgctcact
gccctgctggccatcatcctggtctacctgttctccatcgtgggcttcctctgcctcaag
aatgacttcatcatggaggtggacccactgcctcagataacctcagggcgacatggcaat
gaggaggcatcccaagacttcctcaacacctgcagtaaagatggagtcagctgcactgcc
aaggcaggactccctgctgaacctgaggcagaggagaacaattcggagcgggcctgtgac
actctgctcatgtgtatcgtcactgtgctgaaccacggcttgaggaacggtggcggggtg
ggagacgtgctacgcaggccctccaaaaacgagcccctgttcccagcccgcgtcatctac
gatctcctcttctacttcattgtcatcatcatcgtactcaacttgatctttggtgtcatt
atcgacaccttcgctgacttgcgtagtgagaaacagaagaaagaggaggtcctcaagacc
acctgcttcatctgtggtctggagagggacaagtttgacaataaaacggtgtcttttgag
gagcacataaagttggaacacaacatctggaactacctgtatttcatcgtgcttgttcgc
gagaagaacaagacggactacactggaccagagagttatgtggccctcatgataaagagt
aagaacctggactggttcccccgcatgcaggccatgtccctggtggtgacggatggagac
ggcgaccagaacgagatgaggaacctgcaggacagactgacgtctactatgaacgtggtc
agccaactcacaggacagctaacagagctcaaagagcagatgacggatcagaggaagagg
cggcagcggatgggctttgtggatgtccagtcaggaggaggagctggtgctgctagcatg
tcccccagtgttgctggaggaaaccatctgatgtccaacaaaccctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232084
Entry
112232084         CDS       T05605                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2-like isoform X1
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112232084
   04020 Calcium signaling pathway
    112232084
   04070 Phosphatidylinositol signaling system
    112232084
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112232084
   04210 Apoptosis
    112232084
   04218 Cellular senescence
    112232084
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112232084
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112232084
   04625 C-type lectin receptor signaling pathway
    112232084
  09152 Endocrine system
   04912 GnRH signaling pathway
    112232084
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112232084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112232084
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112232084
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR Flu_B_M2
Other DBs
NCBI-GeneID: 112232084
NCBI-ProteinID: XP_024254646
LinkDB
Position
Unknown
AA seq 1698 aa
MSDNRSSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVQPDAGDLAIPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNNYTEADLFKKLQHAAELEQKQNDTENKKLLGEVVKYSN
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPSGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNPGCKEVNALNCNTSWKVTLFMKFSDYREDVLKGGDV
VRLFHAEQEKFLTCDEYRNQQHIFLRTTLRQSATSATSSKALWEIEVVHYDPCRGGAGQW
NSLFRFKHLATGSYLAAEMNPDFRDESLDSKAEVSQTEMDTVYSQRKRQAAEKIAYTLVS
VPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTNFPIDTEEERPVMLK
IGTCRTKEDKEAFAIVSVPLSEVRDLDFANDANKVLESTVRQLQCGNIAQNDRRFVTKLL
EDLIFFVCEVPNNGQDVLSVVISNPNRERQKLMREQNILAQIFGILKAPFTDQGEGPMLK
LEDLGDQRYAPFKYMLRLCYRVLRHSQQDYRKNQEYIAKKFSIMQSQIGYEILAEDTITA
LLHNNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNKMAIPVTQELICKFIL
NPANAEILIQTKLIPSMETTLQSSMLQEDTEEDEEVWLYWIDSHKEPHGKSIRHLAQDAK
GNHKLDNDVITYYRYQLNLFAKMCLDRQYLAINQVSSQLPVDLILRCMFDECLPYNLRAS
FCRLMMHMHVDREPQEAVVAVRYARLWTEIPSKITIHEYEYEFTDTSREEMKRKFAPTME
FVEEYLKDVVSQPFPFGDEEKNELTLEVVHLARNLVYFGFYSFSELLRLTRTLLAILDFV
QHPLNDIAELSKSPEAGNNVFRTIHGVGEMMTQMVLSRGHIQPHHLPNTPPSLQDRKQPL
CLTDNEDVMVMDTKLKIIEILQFILSVRLDYRITYLLSIYKKEFGDSNLPDSSMSLSEFP
SMSVSDPDIDEIAAKAETMFAGSSECSAVELDDEGGRTFLRVLIHLIMQDYTPLVSGSLQ
LMFKHFSQRAEVLQAFKQVQLLVSEQDVENYKQIKTNLDQLRLAVEKSELWVEKSGGYGS
EDIGDSQAKEQTMEEAGILSPVQDGDVKPHIDSNKANNYNIVKEILLRLSKLCYPSKKSC
VQQQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEIMTLAHVFLQYFCRGNSQNQALLHKYL
NLFLTPGLLEAETMRHIFMNNFHLCNEISDRVVHHFVHCIETHGRHVQYLKFLLTIVKAD
GKYVKKCQDKVMTELVNGGEDVLVFYNDRSSFPVLFQMMCCEMERRDEGGALAYHNTLVE
LLAVCTEGKNVYTELKCNSLLPLDDIVKVVTHEDCIPEVKTAYVNFVNHCYVDTEVEMKE
IYTSHHIWKLFENFLVDMARVCISTTDRNHANIPLERYVTETVMAIVKGFFSSQFPVNNS
NLQTHQPIFIQLLQSSFRIYTCTWISSAQKNNIEGCIKTLSDVAKARAIAIPVDLDSQVN
TLSLKAHTYRVERAVKDWRTSARTRVRKEILGVPDYKSIIEKLQGVVACLEEQFSPMVQA
EFSVLVDVLHSPELLFPEAARLRCESGAFMSKLIKHTKKLMDKEEKLCIKILQTLREMLD
KKKAFDEPVSTEPDMSRV
NT seq 5097 nt   +upstreamnt  +downstreamnt
atgtcagacaacagatctagttttcttcatattggagacattgtgtcgctttacgcggaa
ggcactgtcaatggcttcatcagtacattggggcttgttgatgacaggtgtgtggtgcag
ccggacgcaggagacctggccattccgcccaaaaagttcagagactgcctgttcaaggta
tgtccgatgaacaggtactcggctcagaagcagttctggaaggccaaacagggcaaacaa
ggcaacaactacacagaagcagacctattcaagaagttacagcatgcagcagaactggaa
cagaagcaaaacgacaccgagaataagaagctgcttggagaggtggtcaagtacagtaac
gtcatccagcttctgcatattaaaagtaacaagtacctgacggtgaacaagcgtctgccg
gcgctgctggagaagaacgccatgcgtgtgtctctggacccatctggcaatgagggctct
tggttctacatccagcccttctggaagctccgcagcgagggtgataatgtggtggtggga
gacaaggtggtcctgatgcctgtgaatgcaggacagcctctccacgccagcaacattgag
ctgctagacaaccccggctgcaaagaggtgaacgctttgaactgcaacaccagctggaag
gtcactctgttcatgaagttcagtgactacagagaggacgtcctcaaaggaggtgatgtg
gtgcgtctgttccacgccgagcaggagaagttcctgacatgtgacgagtacaggaatcag
cagcacatcttcctcaggaccaccctgcgacagtctgccacctccgccaccagctccaaa
gcactctgggaaatagaggttgtgcactacgacccctgcagagggggtgctggccagtgg
aacagcctgtttcgcttcaaacacctggccactgggagctacctggctgcagagatgaat
cctgatttccgggatgagagtttggattctaaagcagaggtgagtcagacggagatggat
acagtgtactcccagaggaagcgtcaggctgcagagaagatagcctacaccctggtgtct
gtgccccatggcaacgacatcgcctctctgtttgagctggacgccaccacgctgcagagg
gctgactgtctggtgcccaggaactcttatgtacggctgaggcacctatgtaccaacacc
tgggtgactagcaccaactttcccatcgacactgaggaggagcgccccgtcatgctcaag
attggcacttgccgtacgaaggaggacaaggaggcatttgccattgtctctgttcccctg
tctgaggtccgagacctggactttgctaacgatgccaacaaggtcctggagtcgaccgtg
aggcagctgcagtgtggcaacattgctcagaacgataggaggtttgtgaccaagctgttg
gaggacctgatcttctttgtgtgcgaggtccccaacaacggtcaggacgtactgtctgtg
gtcatctccaacccgaacagagagaggcagaaactaatgagggaacagaacattctagcc
cagatttttggtattctgaaggccccgttcacagaccagggggagggtcccatgctgaag
ctggaggacttgggggaccagcgctacgctccctttaagtacatgctgcggctgtgctac
cgagtgttgcgccactcccaacaggactaccgcaagaaccaggagtacatagccaagaag
ttctccatcatgcagtctcagatcggttatgaaatcctggcagaggacaccatcactgcc
ctgctccacaacaaccgcaagctgctggagaaacacatcacagccaaggagatcgagacc
ttcgtcaatctgctgcgtcgcaaccgagagcccaggtttctggactacctgtcagacctg
tgcgtgtccaataagatggccatcccagtgacacaggagctcatctgtaaattcattctg
aaccccgccaacgctgagatcctcatccagaccaagctcatccccagcatggagactacc
ttgcagtcgtccatgctgcaggaggacaccgaggaggacgaggaggtgtggctctactgg
attgacagccacaaggagccacacggcaagtccatccgccacctggcccaggatgcaaag
ggcaaccacaagctggacaacgacgtcatcacctactacagataccagctcaacctgttt
gccaagatgtgtctggaccgccagtacctggccatcaaccaggtgtccagccagctgccc
gtggacctgatcctgcgctgcatgtttgacgaatgtctgccctacaacctgcgcgcctcc
ttctgccgcctcatgatgcacatgcacgtggaccgcgagccacaggaggcagtggtggcc
gtgcgctacgcccgcctctggaccgagatcccctccaagatcaccatccacgagtatgag
tacgagttcactgacacctccagagaggagatgaagaggaagtttgcccccaccatggag
tttgtagaggaatacctcaaagacgtggtcagccagccctttccctttggagacgaagag
aagaatgaactgactctggaggtggtgcacctggcccgtaacctggtttattttggcttc
tacagcttcagtgagctgctgcgtctcacacgcaccctgctggccatcctggactttgtc
cagcacccgcttaacgacattgccgagctcagcaagagccccgaggcagggaacaacgtg
tttcgtaccatccacggtgtgggagagatgatgactcagatggtgctgagtcgagggcac
atccagcctcaccacctcccgaacacacccccgtcccttcaggacagaaaacaaccactc
tgtctgacagacaacgaggatgtcatggtcatggacaccaagctcaaaatcattgagatt
ttacagtttattctgagtgtgcgactggactataggatcacctacctgttgtccatctat
aagaaagagtttggggacagtaatctaccggacagctctatgtcattgtctgaatttccc
tccatgtcagtttcagatccagacattgatgagattgcagccaaagcagagacaatgttt
gctggaagttcagagtgtagtgctgtggagctggatgacgagggaggcaggaccttcctg
agggtactgatccatctcatcatgcaggactacaccccgctggtgtccggctcgctgcag
ctcatgttcaaacacttcagccagagagccgaggtcctacaggccttcaaacaggtgcag
ttgctggtttcggagcaggatgtggagaactacaagcagatcaagactaacctggaccag
ctcaggctggcggtggagaagtctgaactgtgggtggagaagagtggaggctacggcagt
gaggacataggagacagccaggccaaggagcagaccatggaggaggcgggcatcctgagt
ccagtacaggatggggatgtgaagcctcatatagacagcaacaaagctaacaactacaac
atcgtcaaagagatcctgctgcggctcagtaagctgtgttaccccagtaagaagagttgt
gtgcagcagcagaggctgctgaagaacatgggggctcactctgtggtgctggacctgctc
cagataccttatgagaagaatgatgagaagatgaatgagatcatgacactggcccatgta
ttcctgcagtacttctgtagaggcaacagccagaaccaggctctgctccacaaatacctc
aacctgttccttacaccagggctcctggaggctgagaccatgcgccacatcttcatgaac
aacttccacctgtgcaacgagatcagcgaccgcgtggtccaccattttgtccactgcatc
gagacgcacggccgacacgtccagtacctcaagttcctcctgaccatcgtcaaggccgac
gggaagtacgtgaaaaagtgccaggacaaggtcatgaccgagctggtgaacggtggcgag
gatgtgctggtgttctacaacgaccgctcctccttcccggtgctgttccagatgatgtgc
tgcgagatggagcgtagggacgagggcggcgccctggcctaccacaacactctggtagag
ctcctcgctgtctgcaccgagggcaagaacgtatacaccgagctgaaatgtaactccctg
ctgcccctcgatgacattgtcaaagtggtcacccacgaagactgcatccctgaggtgaag
actgcctacgtgaactttgtaaaccactgctacgtggacactgaggtggagatgaaggag
atctacaccagccaccacatctggaagctctttgagaacttcctggtggacatggcacgg
gtgtgcatcagcaccacggaccgtaaccatgccaacattcccctggagaggtacgtgacg
gagacggtgatggccatcgtcaagggcttctttagctcccagttccctgtcaacaactcc
aacctgcagacccaccagcccatcttcatccagctgctccagtcctccttcaggatctat
acctgcacctggatcagctcggcccagaagaacaacatcgagggctgcatcaaaacactg
tctgacgtggctaaggcgcgtgccatagccatcccggtggatctggacagccaggtgaac
actctgtctctgaaggcccacacctacagggtggagcgtgccgtaaaggactggaggacc
tcagcacgcacccgggtccgcaaggagattctgggagtgcctgactacaagagcatcatc
gagaagctgcagggtgtggtggcgtgtctagaggagcagttcagtcctatggtgcaggct
gagttctctgtgttggtggatgtactacacagccctgagctgctgttcccagaggctgcc
agactgcgctgtgagagcggggccttcatgtccaaactgatcaaacacaccaagaagctg
atggacaaggaggaaaagctgtgcattaagatcctgcagacactccgagagatgctggac
aagaagaaggcctttgatgagcctgtgagtactgaaccagacatgtcaagggtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232649
Entry
112232649         CDS       T05605                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3-like
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112232649
   04020 Calcium signaling pathway
    112232649
   04070 Phosphatidylinositol signaling system
    112232649
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112232649
   04210 Apoptosis
    112232649
   04218 Cellular senescence
    112232649
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112232649
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112232649
   04625 C-type lectin receptor signaling pathway
    112232649
  09152 Endocrine system
   04912 GnRH signaling pathway
    112232649
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112232649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112232649
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112232649
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112232649
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112232649
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 112232649
NCBI-ProteinID: XP_024255605
LinkDB
Position
Unknown
AA seq 2680 aa
MSDSMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDYPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQAKHEKDKIADVVLLQKLQHASNLEQKQNETENKKVHGDVVKYG
TVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWMFIQPFWKLRANGDNVVV
GDKVILNPVNAGQPLHASNYELSDHAGCKEVNSVNCNTSWKINLFMMFSDHKDEVLKGGD
VVRLFHAEQEKFLTCDEYKVKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGH
WNSLYRFKHLATGNYLAAEENPGYKGDSVEIQTSANEDTLDSRGKLKMLGERIKYKLVAV
PHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLML
GTCPTKEDKEAFAIVSVPVMEIRDLDFANDASFMLSTIVDRFNEGFISPNDRRFAIKLLE
DLVFFVVDTPNSGQVVLDVAMTKANRERQKLMREQNILKQIFGILKAPFKDKGTEGPLLR
LEELSDQKNSPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGVMQSQIGYDILAEDTITA
LLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVL
DPKNQDILIKTERRVPKEIPNATEYMGMEEYADDDEVWLVWTDKTNEKQEKGIRQLAQEA
RQGNAHDENVLTYYRYQLKLYARMCLDRQYLAIDEISKQLDVELIFLCMMDETLPFDLRA
SFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTSITIKDYDSNMDDSRDNKKNKFANTMV
FMEEYLNNVLNDDLPFADEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCI
PNPSLINPMFQDDGSGKNMKRSIHGVGQMMSTMVLSRKQSIFGGPGRSASNIEGQNRSKD
SIDKQDITVMDTKLKILEILQFILNVRLDYRLSFLLSVFKKEFVDVYPMADADATTSMEQ
AATINLQHIGEQAEAMFGVGKGNSILEVDDEGGRMFLRVLIHLTMHDYPPLVSGALQLLF
KHFSQRQEVLHTFKQVQLLISGQDVDNYKLIKSDLDRLRTMVEKSELWVDKKSSSGGGEG
KKDKKDKKENVEMASEVATPKKEKSDKSNENYQKVKDILERLNKMCSSGVWKKQQRLLKN
MGAHKVMLDLLQVSYDQHDTKMQGIIKCTHLFLQKFCMGNLENQMLLHKNLSLFLNPGLM
EAETVQHIFSNNYQLCTEISENVLQHFIHCLATHGRHVQYLNFLHTIIKAEGKYVKKCQD
MIMTELTNAGEDVVVFYNDKASFATMLELMAESREGVQEHSPLRYHISLVELLSACAEGK
NVYTEIKCTSLLPLEDVVRVVTHEDCITEVKVAYVNFVNHCYVDTEVEMKEIYTSNHIWK
LFEDFTVDMARVCNKREKRLTDPILEKYIINVVFDTINAFFSSPFSENSTSLQTHHTIVT
QLLQSSMRLLECPWLQQQHRGLVETCIRTLAMTAKNRSISLPLDLESQITTMLSSSAPNS
LSRSNPNYKSSTRSSRPSAPNNPWDYKNIIEKLQDIINTLEERLKPLVNAELSVLVDVLH
QPELLFLEGTDARQRCESGGFISKLIQHTKALMSSEEKLCIKVLRTLQEMLIRTLDFDEK
GITLRKVLLQNYLFTNKKNSKGDLVDLGVTGAEQERDWMAVASVQCRLDREGGTKLFTDL
VMSTKNDKIFQESIQLAICLLEGGNTEIQNSFYKLMMGDNKSEKFFKVLHDRMKNAQMDI
KANVSVSVGEMSNKANDNKDLETSSGGLVLPATTLPLLAPSIAQVNALASEPEQKEVETE
MGPAIIIMKPILRFLQLLCENHNQDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGL
GLLGLYINESNVELITQTLETLTEYCQGPCQENQTCIVTHESNGIDIITALILNDISPLC
RYRMEMVLQLKDNASKLLLALMESRHDNENAERILFNLRPRELVKVIKKAYQQESECQGG
EVSPQEVGHNIYILALQLARHNKILLNLLKPAKRTKEGEEGISSMLNLNNRPLSQMLKST
VPVESEEQDPLEFYEQHTSQIEIVREDRSMEQIVFPIHPICEFLTEESKFRVFNTTEQDE
QGSKVTHFFQQASFLHNEMEWQKKLRSMPVLFWFSRRMSTWGSISFNLAVFINLIIAFFY
PYDSGQGAIDDSMLSMLFWGFLGLSVMGMFSKRYGLRPFTVALILRSIYCFGIGPTLILL
GTLNLINKIVFVVSFVGNNGTFIMGYRAMVMDVEFLYHLAYVLTSTLGLCVHELFYSFLL
FDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLCLKNDFIMEVDPLPQI
DSGGHGNEEASQDFLNSCSGDGVSCTAEAGLPAEPDEENNSERACDTLLMCIVTVLNHGL
RNGGGVGDVLRKPSKNEPLFPARVIYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKK
EEVLKTTCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVLVREKNKTDYTGPESYV
ALMIKSKNLDWFPRMQAMSLVVTDGDGEQNEMRNLQDRLTSTMNVVSQLTGQLTELKEQM
TEQRKRRQRMGFVDVQSGGAGAASVTPSAAGGNHQMFNKP
NT seq 8043 nt   +upstreamnt  +downstreamnt
atgtcggattcaatgtccagctttttgcacattggggacatcgtttccctttacgcagag
ggctctgtcaatggttttataagtacacttgggttggtggatgaccgatgtgtggtagaa
ccagctgcaggggacctggactatccccccaagaagttcagagactgcctcttcaaagtg
tgtcccatgaaccgttactctgcacagaagcagttctggaaagccaagcaggccaagcac
gagaaggacaagatcgctgatgttgtgctacttcagaaactacagcatgcctctaacctg
gaacagaaacagaatgagaccgaaaacaagaaagtccacggagatgtagtaaaatatggc
actgtcattcagctgttgcatatgaagagtaataaatacctgactgtgaataagcgtctg
cctgccctgctggagaagaatgccatgcgggtcaccctggacggaacggggaatgagggc
tcctggatgttcatccaacccttctggaagctaagggccaacggagacaatgtagtggta
ggagataaggtgatcctgaacccagtgaatgcaggccagcccctacatgccagtaactat
gagctctctgaccacgctggatgcaaagaggttaattctgtgaactgcaatactagctgg
aaaatcaacctgttcatgatgttcagtgaccataaggatgaagtcttgaaaggaggggat
gtggtgcggttgttccatgcggagcaggagaagttcctgacctgtgatgagtacaaggtc
aagctgcatgtgttcctccgtaccaccctgcgccagtctgctacctctgccaccagctcc
aatgccctgtgggaagtggaggtggtgcaccatgacccatgtcgaggaggggccggacac
tggaacagtctgtaccgctttaaacaccttgccacagggaactatcttgcagctgaggaa
aatccgggttataaaggtgacagcgttgaaatccagacttcggcgaatgaagatacgctg
gacagtagaggaaaactaaagatgttgggtgagaggataaagtacaagctggtggctgtg
cctcatgggaatgacattgcttccttgtttgagctagaccccaccactctgcagaaaaca
gactcctttgtgccaaggaattcatatgtgcgtctcagacacctatgcaccaacacatgg
atccagagtaccaacgtgcccatagatatcgacgaggagagacccatccggctcatgctg
ggcacctgccctaccaaggaggataaggaggcatttgccatagtgtcagtgccagtgatg
gagatccgggatctggactttgccaatgatgccagtttcatgttgagcaccatagtggac
aggttcaatgagggctttatcagtcccaatgacagaagatttgccattaagctgctggag
gatctggtgttctttgtggtggacacgcccaacagcggccaggtcgtcctggatgtggcg
atgaccaaggccaaccgcgagagacagaaactcatgagggaacaaaacatcctcaaacag
atctttgggatcttgaaggcccctttcaaagataaggggacagagggcccgttgctgcga
ttggaggagctgtcagaccagaagaattccccttaccagtacatgttccgtctctgttac
cgggtactgcgacactctcaggaagactaccgcaagaaccaggagcacatagccaagcag
tttggggtgatgcagtctcagattggctatgacatcctggctgaggacaccatcactgct
ctgctgcacaacaaccgcaagctgctggagaaacacatcaccaagacggaggtggagacc
tttgttagcctggtccgcaagaacagggaacccaggtttctggactacctgtcagatctg
tgtgtgtccaacaacgtggccattcctgtcactcaggagctgatctgtaagtgtgtgctg
gatcccaagaaccaagacatcctcataaagactgaacggcgtgtgcccaaagagattccc
aatgccactgaatacatgggcatggaggagtatgctgacgatgatgaggtgtggctggtc
tggactgacaagaccaatgagaagcaagagaagggcatcagacaactagcccaggaggcc
agacaggggaacgctcatgacgagaacgtgctcacgtactacaggtaccagctgaagctg
tatgcacgaatgtgtctagaccgccagtacctggccatagatgagatctccaagcagctg
gatgtggagctcatcttcctgtgcatgatggacgagacactgccctttgacctgcgcgcc
tctttctgcagactgatgctgcatgcgcacgtcgaccgagacccccaggagctggtcacg
cccgtcaagttcgcccgcctctggacagagatccccacctccatcacaattaaagattat
gactccaacatggatgactcgcgagacaataagaagaacaagtttgccaacaccatggtg
ttcatggaggagtacctcaacaacgtcctcaatgatgacttgcctttcgctgacgaggaa
aagaacaaactgacctatgaggtggtgagcctggccagacacctcatctactttggcttc
tacagtttctttgagctgctgaggttgacacggacccttctgggaatcatcgactgcatc
cccaacccttccctcatcaaccccatgttccaggacgatggcagtgggaaaaacatgaag
cgttccatccatggtgttggccagatgatgtccaccatggtactgagcaggaaacagtcc
atttttggaggtccaggccggagtgcttccaacatagagggccagaaccgcagtaaggac
agcatcgacaaacaggacatcactgtcatggacaccaagctgaaaatactagaaatcctg
cagtttatcctgaatgtccgcctggactatcggctctccttcctgctttctgtcttcaag
aaagagtttgttgatgtttatcccatggcagatgccgatgctacaacatcaatggagcaa
gcagccaccatcaacctgcagcacataggagagcaggcagaggccatgtttggtgtaggg
aaggggaacagtattctggaggtggatgatgagggaggtcgtatgttcctgagggtgctg
atccatctcaccatgcatgactaccctcctctggtctctggggctctacagctgctcttc
aaacacttcagccagagacaggaggtgctgcacacattcaaacaggtccagttgctgatc
tcgggccaggatgttgataactacaagctgataaagagcgaccttgaccgtctccgcacc
atggtggagaagtctgagctctgggtggacaagaagagcagctctggaggaggggagggg
aagaaagacaagaaggacaaaaaagagaatgtagagatggcctcagaggttgcgaccccc
aaaaaagagaagtcggataagagcaatgagaactaccagaaagttaaagatatcttggag
cgtctgaataagatgtgcagctcgggtgtgtggaagaaacagcagagacttctgaagaac
atgggagcccacaaagtgatgctggatctgctgcaagtgtcatacgatcagcatgacacc
aagatgcaggggatcatcaagtgcactcacctgttcctgcagaagttctgcatggggaac
ctggagaaccagatgctcctccataagaacctcagtctctttctcaacccaggactcatg
gaggcagagacggtgcagcacatcttcagcaataactaccagctgtgtacagagatcagt
gagaacgtgctgcagcacttcatccactgcctggccactcacggacgccacgtccagtac
ctgaacttcctgcacactatcatcaaggccgagggcaagtacgtgaagaagtgccaggac
atgatcatgacggagttaaccaacgctggtgaggatgtagtggtgttttataatgacaag
gcatcatttgccaccatgctggagctgatggcagagtccagggagggggttcaggagcac
agccccctgcgctaccacatctctctggtagagctgctatctgcctgcgctgagggaaag
aacgtttacacagagatcaaatgtacctcgctgctgcccctagaggacgtggtgagagtg
gtcacacacgaggactgcatcacagaggtgaaggttgcctacgtgaactttgtgaaccac
tgctacgtagataccgaggtagagatgaaggagatttacaccagcaaccacatctggaaa
ctgtttgaggacttcactgtggacatggccagggtgtgtaacaagagagagaagcgtctg
actgaccccatcctggagaagtacatcatcaacgtggtgtttgataccatcaatgccttc
ttcagctcccccttctctgaaaacagcacctctctacagacccaccacaccatagtaaca
cagctgctccagtctagcatgcgcctgctggaatgtccctggctacagcagcaacacaga
ggcctggtggagacctgcatccgcaccctggctatgacagcgaagaaccgctccatttcc
ctgcctctggacctggagtctcagatcaccaccatgctgagcagcagtgctcccaactct
ctgtcccgctccaaccccaactacaagagctccacccgctccagccgcccctccgccccc
aacaacccctgggactacaagaacatcatcgagaagctgcaggacattatcaacaccctg
gaggagcgtctgaagccgctggtgaacgcagagctgtctgttctggtggacgtcctgcat
cagcctgaactcctcttcctggaggggacggatgcacggcaacgctgcgaatcaggaggc
ttcatctccaaactgattcagcacactaaagccctgatgagctcagaggagaagctctgt
atcaaggttctgaggaccctgcaggagatgctcatacgcacactggactttgacgagaag
ggcattacactgaggaaggtgctgctacagaactacctcttcaccaacaagaagaacagc
aagggagatctggttgaccttggagtaacaggtgctgagcaggagagagactggatggct
gtagcatcagtccagtgtcgcctggacagggagggtggcacaaagctctttactgacctc
gtcatgagcaccaagaacgacaagatcttccaggagagcatccagctggccatatgtctg
ctggaggggggcaacacagagatccagaactccttctacaagctgatgatgggggacaac
aagtctgagaagttcttcaaggtcctccacgaccggatgaaaaacgcccagatggatatc
aaggccaacgtatcagtcagcgtgggggagatgagtaacaaagccaatgacaacaaagac
ctggagaccagctctggtgggttggttctacctgcgactactctgcctctcttggccccc
tccatcgcccaggtcaatgccctggcttcggagcctgagcagaaggaagtggagaccgag
atgggccctgcaatcatcattatgaaacccatcctgcgcttcctccagctgctctgtgag
aaccacaaccaggatctgcagaacttccttcgctgccagaacaacaagaccaactacaac
ctggtatgtgagacattgcagttcctggacatcatgtgtggcagcaccaccggaggcctg
ggtctgctgggcctctacatcaatgagagcaacgtggaactcatcacccagaccctggag
acgctcacagagtactgccagggcccctgccaggagaaccagacttgtatagtgacccat
gagtcgaatggcatcgacatcatcacagccctcatactgaatgacatcagtcctctgtgt
cgttaccgcatggagatggttctgcagctcaaggacaacgcctccaagctgctactggct
ctgatggaaagtcgccatgacaacgagaatgcagagaggatactgttcaacctccgacct
cgggaactggtgaaggtgataaagaaagcctaccagcaggagagtgaatgtcaaggtgga
gaggtgtcacctcaagaggtcggccacaacatctacatcctggcactccagctggcgagg
cacaataagatcctgctcaatctgctgaaacctgcaaagaggaccaaggagggagaggag
ggcatatcctctatgttgaacctgaacaatcggcctctctctcaaatgttgaaatctacc
gtgccggtagagagcgaggagcaggacccactggagttctatgagcagcacacttcacag
atagagattgtgcgtgaggaccgcagcatggagcagatcgtgtttcccattcatcccatc
tgtgagttcctgacggaggagtccaagttccgtgtgttcaacaccacygagcaggacgag
cagggcagcaaggtcacacacttcttccarcaggcctccttcctccacaacgagatggag
tggcagaagaagctgcgcagtatgccggtgctgttttggttctctcgcaggatgagcacc
tggggcagcatctcctttaacctggccgtcttcatcaacctcatcatcgcattcttctac
ccttacgactcaggccaaggtgcaatagatgactcgatgctgtccatgctgttctggggt
ttcctgggtctgtctgtcatgggcatgttttccaaacgctacggcctcaggcccttcact
gtggccctcatactgcgctccatatactgcttcggcatcggccccactctcatcctactg
ggcaccctcaatctgataaataagatagtgtttgtggtgagctttgtgggcaacaacggg
acatttatcatgggctaccgtgcgatggtgatggacgtggagttcctttaccacctggcc
tatgttctgaccagcaccctggggctctgtgtccatgagctcttctacagcttcctgctg
tttgatctgatctaccgagaggagaccctgttcaacgtgataaagagtgtgacccggaat
gggcgctccatcctgctcactgccctgctagcccttatcctggtctacctgttctccatt
gtgggcttcctctgcctcaagaacgacttcatcatggaggtggaccctctgcctcagatc
gactcagggggacatggcaatgaggaggcatcacaggacttcctgaactcctgcagtgga
gatggagtcagctgcactgccgaggcaggactccctgctgaacctgatgaggagaacaat
tcggagcgggcctgtgacactctgctcatgtgcattgtcaccgtgctgaaccacgggctg
aggaacggtggaggggtgggagatgtgctacgcaagccctccaaaaacgagccactgttc
ccagcccgcgtcatctacgatctcctcttctacttcattgtcatcatcatcgtactcaac
ttgatctttggtgtcatcatcgacaccttcgctgacttgcgtagtgagaaacagaagaaa
gaggaggtcctcaagaccacctgcttcatctgtggtctggagagggacaagtttgacaat
aaaacggtgtcttttgaggaacacataaagttggagcacaacatctggaactacctgtat
ttcatcgtgcttgttcgtgagaagaacaagactgactacacaggtccagagagttatgtg
gccctcatgataaagagtaagaacctggactggttcccccgcatgcaggccatgtccctg
gtggtgacggatggagacggggagcagaatgaaatgaggaacctgcaggacagactgacg
tccactatgaacgtggtcagccaactcacaggacagttaacagagctcaaagaacagatg
acggagcagaggaagaggaggcagaggatgggcttcgtggatgtccagtcaggaggagct
ggtgcagctagtgtaacccccagtgctgctggaggaaaccaccagatgttcaacaaaccc
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244593
Entry
112244593         CDS       T05605                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3-like
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112244593
   04020 Calcium signaling pathway
    112244593
   04070 Phosphatidylinositol signaling system
    112244593
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112244593
   04210 Apoptosis
    112244593
   04218 Cellular senescence
    112244593
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112244593
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112244593
   04625 C-type lectin receptor signaling pathway
    112244593
  09152 Endocrine system
   04912 GnRH signaling pathway
    112244593
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112244593
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112244593
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112244593
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112244593
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112244593
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 112244593
NCBI-ProteinID: XP_024268080
LinkDB
Position
Unknown
AA seq 2680 aa
MSDSMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDYPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQAKHEKDKIADVVLLQKLQHASNLEQKQNETENKKVHGDVVKYG
TVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWMFIQPFWKLRANGDNVVV
GDKVILNPVNAGQPLHASNYELSDHAGCKEVNSVNCNTSWKINLFMMFSDHKDEVLKGGD
VVRLFHAEQEKFLTCDEYKVKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGH
WNSLYRFKHLATGNYLAAEENPGYKGDSVEIQTSANEDTLDSRGKLKMLGERIKYKLVAV
PHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLML
GTCPTKEDKEAFAIVSVPVMEIRDLDFANDASFMLSTIVDRFNEGFISPNDRRFAIKLLE
DLVFFVVDTPNSGQVVLDVAMTKANRERQKLMREQNILKQIFGILKAPFKDKGTEGPLLR
LEELSDQKNSPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGVMQSQIGYDILAEDTITA
LLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVL
DPKNQDILIKTERRVPKEIPNATEYMGMEEYADDDEVWLVWTDKTNEKQEKGIRQLAQEA
RQGNAHDENVLTYYRYQLKLYARMCLDRQYLAIDEISKQLDVELIFLCMMDETLPFDLRA
SFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTSITIKDYDSNMDDSRDNKKNKFANTMV
FMEEYLNNVLNDDLPFADEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCI
PNPSLINPMFQDDGSGKNMKRSIHGVGQMMSTMVLSRKQSIFGGPGRSASNIEGQNRSKD
SIDKQDITVMDTKLKILEILQFILNVRLDYRLSFLLSVFKKEFVDVYPMADADATTSMEQ
AATINLQHIGEQAEAMFGVGKGNSILEVDDEGGRMFLRVLIHLTMHDYPPLVSGALQLLF
KHFSQRQEVLHTFKQVQLLISGQDVDNYKLIKSDLDRLRTMVEKSELWVDKKSSSGGGEG
KKDKKDKKENVEMASEVATPKKEKSDKSNENYQKVKDILERLNKMCSSGVWKKQQRLLKN
MGAHKVMLDLLQVSYDQHDTKMQGIIKCTHLFLQKFCMGNLENQMLLHKNLSLFLNPGLM
EAETVQHIFSNNYQLCTEISENVLQHFIHCLATHGRHVQYLNFLHTIIKAEGKYVKKCQD
MIMTELTNAGEDVVVFYNDKASFATMLELMAESREGVQEHSPLRYHISLVELLSACAEGK
NVYTEIKCTSLLPLEDVVRVVTHEDCITEVKVAYVNFVNHCYVDTEVEMKEIYTSNHIWK
LFEDFTVDMARVCNKREKRLTDPILEKYIINVVFDTINAFFSSPFSENSTSLQTHHTIVT
QLLQSSMRLLECPWLQQQHRGLVETCIRTLAMTAKNRSISLPLDLESQITTMLSSSAPNS
LSRSNPNYKSSTRSSRPSAPNNPWDYKNIIEKLQDIINTLEERLKPLVNAELSVLVDVLH
QPELLFLEGTDARQRCESGGFISKLIQHTKALMSSEEKLCIKVLRTLQEMLIRTLDFDEK
GITLRKVLLQNYLFTNKKNSKGDLVDLGVTGAEQERDWMAVASVQCRLDREGGTKLFTDL
VMSTKNDKIFQESIQLAICLLEGGNTEIQNSFYKLMMGDNKSEKFFKVLHDRMKNAQMDI
KANVSVSVGEMSNKANDNKDLETSSGGLVLPATTLPLLAPSIAQVNALASEPEQKEVETE
MGPAIIIMKPILRFLQLLCENHNQDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGL
GLLGLYINESNVELITQTLETLTEYCQGPCQENQTCIVTHESNGIDIITALILNDISPLC
RYRMEMVLQLKDNASKLLLALMESRHDNENAERILFNLRPRELVKVIKKAYQQESECQGG
EVSPQEVGHNIYILALQLARHNKILLNLLKPAKRTKEGEEGISSMLNLNNRPLSQMLKST
VPVESEEQDPLEFYEQHTSQIEIVREDRSMEQIVFPIHPICEFLTEESKFRVFNTTEQDE
QGSKVTHFFHQASFLHNEMEWQKKLRSMPVLFWFSRRMSTWGSISFNLAVFINLIIAFFY
PYDSGQGAIDDSMLSMLFWGFLGLSVMGMFSKRYGLRPFTVALILRSIYCFGIGPTLILL
GTLNLINKIVFVVSFVGNNGTFIMGYRAMVMDVEFLYHLAYVLTSTLGLCVHELFYSFLL
FDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLCLKNDFIMEVDPLPQI
DSGGHGNEEASQDFLNSCSGDGVSCTAEAGLPAEPDEENNSERACDTLLMCIVTVLNHGL
RNGGGVGDVLRKPSKNEPLFPARVIYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKK
EEVLKTTCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVLVREKNKTDYTGPESYV
ALMIKSKNLDWFPRMQAMSLVVTDGDGEQNEMRNLQDRLTSTMNVVSQLTGQLTELKEQM
TEQRKRRQRMGFVDVQSGGAGAASVTPSAAGGNHQMFNKP
NT seq 8043 nt   +upstreamnt  +downstreamnt
atgtcggattcaatgtccagctttttgcacattggggacatcgtttccctttacgcagag
ggctctgtcaatggttttataagtacacttgggttggtggatgaccgatgtgtggtagaa
ccagctgcaggggacctggactatccccccaagaagttcagagactgcctcttcaaagtg
tgtcccatgaaccgttactctgcacagaagcagttctggaaagccaagcaggccaagcac
gagaaggacaagatcgctgatgttgtgctacttcagaaactacagcatgcctctaacctg
gaacagaaacagaatgagaccgaaaacaagaaagtccacggagatgtagtaaaatatggc
actgtcattcagctgttgcatatgaagagtaataaatacctgactgtgaataagcgtctg
cctgccctgctggagaagaatgccatgcgggtcaccctggacggaacggggaatgagggc
tcctggatgttcatccaacccttctggaagctaagggccaacggagacaatgtagtggta
ggagataaggtgatcctgaacccagtgaatgcaggccagcccctacatgccagtaactat
gagctctctgaccacgctggatgcaaagaggttaattctgtgaactgcaatactagctgg
aaaatcaacctgttcatgatgttcagtgaccataaggatgaagtcttgaaaggaggggat
gtggtgcggttgttccatgcggagcaggagaagttcctgacctgtgatgagtacaaggtc
aagctgcatgtgttcctccgtaccaccctgcgccagtctgctacctctgccaccagctcc
aatgccctgtgggaagtggaggtggtgcaccatgacccatgtcgaggaggggccggacac
tggaacagtctgtaccgctttaaacaccttgccacagggaactatcttgcagctgaggaa
aatccgggttataaaggtgacagcgttgaaatccagacttcggcgaatgaagatacgctg
gacagtagaggaaaactaaagatgttgggtgagaggataaagtacaagctggtggctgtg
cctcatgggaatgacattgcttccttgtttgagctagaccccaccactctgcagaaaaca
gactcctttgtgccaaggaattcatatgtgcgtctcagacacctatgcaccaacacatgg
atccagagtaccaacgtgcccatagatatcgacgaggagagacccatccggctcatgctg
ggcacctgccctaccaaggaggataaggaggcatttgccatagtgtcagtgccagtgatg
gagatccgggatctggactttgccaatgatgccagtttcatgttgagcaccatagtggac
aggttcaatgagggctttatcagtcccaatgacagaagatttgccattaagctgctggag
gatctggtgttctttgtggtggacacgcccaacagcggccaggtcgtcctggatgtggcg
atgaccaaggccaaccgcgagagacagaaactcatgagggaacaaaacatcctcaaacag
atctttgggatcttgaaggcccctttcaaagataaggggacagagggcccgttgctgcga
ttggaggagctgtcagaccagaagaattccccttaccagtacatgttccgtctctgttac
cgggtactgcgacactctcaggaagactaccgcaagaaccaggagcacatagccaagcag
tttggggtgatgcagtctcagattggctatgacatcctggctgaggacaccatcactgct
ctgctgcacaacaaccgcaagctgctggagaaacacatcaccaagacggaggtggagacc
tttgttagcctggtccgcaagaacagggaacccaggtttctggactacctgtcagatctg
tgtgtgtccaacaacgtggccattcctgtcactcaggagctgatctgtaagtgtgtgctg
gatcccaagaaccaagacatcctcataaagactgaacggcgtgtgcccaaagagattccc
aatgccactgaatacatgggcatggaggagtatgctgacgatgatgaggtgtggctggtc
tggactgacaagaccaatgagaagcaagagaagggcatcagacaactagcccaggaggcc
agacaggggaacgctcatgacgagaacgtgctcacgtactacaggtaccagctgaagctg
tatgcacgaatgtgtctagaccgccagtacctggccatagatgagatctccaagcagctg
gatgtggagctcatcttcctgtgcatgatggacgagacactgccctttgacctgcgcgcc
tctttctgcagactgatgctgcatgcgcacgtcgaccgagacccccaggagctggtcacg
cccgtcaagttcgcccgcctctggacagagatccccacctccatcacaattaaagattat
gactccaacatggatgactcgcgagacaataagaagaacaagtttgccaacaccatggtg
ttcatggaggagtacctcaacaacgtcctcaatgatgacttgcctttcgctgacgaggaa
aagaacaaactgacctatgaggtggtgagcctggccagacacctcatctactttggcttc
tacagtttctttgagctgctgaggttgacacggacccttctgggaatcatcgactgcatc
cccaacccttccctcatcaaccccatgttccaggacgatggcagtgggaaaaacatgaag
cgttccatccatggtgttggccagatgatgtccaccatggtactgagcaggaaacagtcc
atttttggaggtccaggccggagtgcttccaacatagagggccagaaccgcagtaaggac
agcatcgacaaacaggacatcactgtcatggacaccaagctgaaaatactagaaatcctg
cagtttatcctgaatgtccgcctggactatcggctctccttcctgctttctgtcttcaag
aaagagtttgttgatgtttatcccatggcagatgccgatgctacaacatcaatggagcaa
gcagccaccatcaacctgcagcacataggagagcaggcagaggccatgtttggtgtaggg
aaggggaacagtattctggaggtggatgatgagggaggtcgtatgttcctgagggtgctg
atccatctcaccatgcatgactaccctcctctggtctctggggctctacagctgctcttc
aaacacttcagccagagacaggaggtgctgcacacattcaaacaggtccagttgctgatc
tcgggccaggatgttgataactacaagctgataaagagcgaccttgaccgtctccgcacc
atggtggagaagtctgagctctgggtggacaagaagagcagctctggaggaggggagggg
aagaaagacaagaaggacaaaaaagagaatgtagagatggcctcagaggttgcgaccccc
aaaaaagagaagtcggataagagcaatgagaactaccagaaagttaaagatatcttggag
cgtctgaataagatgtgcagctcgggtgtgtggaagaaacagcagagacttctgaagaac
atgggagcccacaaagtgatgctggatctgctgcaagtgtcatacgatcagcatgacacc
aagatgcaggggatcatcaagtgcactcacctgttcctgcagaagttctgcatggggaac
ctggagaaccagatgctcctccataagaacctcagtctctttctcaacccaggactcatg
gaggcagagacggtgcagcacatcttcagcaataactaccagctgtgtacagagatcagt
gagaacgtgctgcagcacttcatccactgcctggccactcacggacgccacgtccagtac
ctgaacttcctgcacactatcatcaaggccgagggcaagtacgtgaagaagtgccaggac
atgatcatgacggagttaaccaacgctggtgaggatgtagtggtgttttataatgacaag
gcatcatttgccaccatgctggagctgatggcagagtccagggagggggttcaggagcac
agccccctgcgctaccacatctctctggtagagctgctatctgcctgcgctgagggaaag
aacgtttacacagagatcaaatgtacctcgctgctgcccctagaggacgtggtgagagtg
gtcacacacgaggactgcatcacagaggtgaaggttgcctacgtgaactttgtgaaccac
tgctacgtagataccgaggtagagatgaaggagatttacaccagcaaccacatctggaaa
ctgtttgaggacttcactgtggacatggccagggtgtgtaacaagagagagaagcgtctg
actgaccccatcctggagaagtacatcatcaacgtggtgtttgataccatcaatgccttc
ttcagctcccccttctctgaaaacagcacctctctacagacccaccacaccatagtaaca
cagctgctccagtctagcatgcgcctgctggaatgtccctggctacagcagcaacacaga
ggcctggtggagacctgcatccgcaccctggctatgacagcgaagaaccgctccatttcc
ctgcctctggacctggagtctcagatcaccaccatgctgagcagcagtgctcccaactct
ctgtcccgctccaaccccaactacaagagctccacccgctccagccgcccctccgccccc
aacaacccctgggactacaagaacatcatcgagaagctgcaggacattatcaacaccctg
gaggagcgtctgaagccgctggtgaacgcagagctgtctgttctggtggacgtcctgcat
cagcctgaactcctcttcctggaggggacggatgcacggcaacgctgcgaatcaggaggc
ttcatctccaaactgattcagcacactaaagccctgatgagctcagaggagaagctctgt
atcaaggttctgaggaccctgcaggagatgctcatacgcacactggactttgacgagaag
ggcattacactgaggaaggtgctgctacagaactacctcttcaccaacaagaagaacagc
aagggagatctggttgaccttggagtaacaggtgctgagcaggagagagactggatggct
gtagcatcagtccagtgtcgcctggacagggagggtggcacaaagctctttactgacctc
gtcatgagcaccaagaacgacaagatcttccaggagagcatccagctggccatatgtctg
ctggaggggggcaacacagagatccagaactccttctacaagctgatgatgggggacaac
aagtctgagaagttcttcaaggtcctccacgaccggatgaaaaacgcccagatggatatc
aaggccaacgtatcagtcagcgtgggggagatgagtaacaaagccaatgacaacaaagac
ctggagaccagctctggtgggttggttctacctgcgactactctgcctctcttggccccc
tccatcgcccaggtcaatgccctggcttcggagcctgagcagaaggaagtggagaccgag
atgggccctgcaatcatcattatgaaacccatcctgcgcttcctccagctgctctgtgag
aaccacaaccaggatctgcagaacttccttcgctgccagaacaacaagaccaactacaac
ctggtatgtgagacattgcagttcctggacatcatgtgtggcagcaccaccggaggcctg
ggtctgctgggcctctacatcaatgagagcaacgtggaactcatcacccagaccctggag
acgctcacagagtactgccagggcccctgccaggagaaccagacttgtatagtgacccat
gagtcgaatggcatcgacatcatcacagccctcatactgaatgacatcagtcctctgtgt
cgttaccgcatggagatggttctgcagctcaaggacaacgcctccaagctgctactggct
ctgatggaaagtcgccatgacaacgagaatgcagagaggatactgttcaacctccgacct
cgggaactggtgaaggtgataaagaaagcctaccagcaggagagtgaatgtcaaggtgga
gaggtgtcacctcaagaggtcggccacaacatctacatcctggcactccagctggcgagg
cacaataagatcctgctcaatctgctgaaacctgcaaagaggaccaaggagggagaggag
ggcatatcctctatgttgaacctgaacaatcggcctctctctcaaatgttgaaatctacc
gtgccggtagagagcgaggagcaggacccactggagttctatgagcagcacacttcacag
atagagattgtgcgtgaggaccgcagcatggagcagatcgtgtttcccattcatcccatc
tgtgagttcctgacggaggagtccaagttccgtgtgttcaacaccacrgagcaggacgag
cagggcagcaaggtcacacacttcttccaycaggcctccttcctccacaacgagatggag
tggcagaagaagctgcgcagtatgccggtgctgttttggttctctcgcaggatgagcacc
tggggcagcatctcctttaacctggccgtcttcatcaacctcatcatcgcattcttctac
ccttacgactcaggccaaggtgcaatagatgactcgatgctgtccatgctgttctggggt
ttcctgggtctgtctgtcatgggcatgttttccaaacgctacggcctcaggcccttcact
gtggccctcatactgcgctccatatactgcttcggcatcggccccactctcatcctactg
ggcaccctcaatctgataaataagatagtgtttgtggtgagctttgtgggcaacaacggg
acatttatcatgggctaccgtgcgatggtgatggacgtggagttcctttaccacctggcc
tatgttctgaccagcaccctggggctctgtgtccatgagctcttctacagcttcctgctg
tttgatctgatctaccgagaggagaccctgttcaacgtgataaagagtgtgacccggaat
gggcgctccatcctgctcactgccctgctagcccttatcctggtctacctgttctccatt
gtgggcttcctctgcctcaagaacgacttcatcatggaggtggaccctctgcctcagatc
gactcagggggacatggcaatgaggaggcatcacaggacttcctgaactcctgcagtgga
gatggagtcagctgcactgccgaggcaggactccctgctgaacctgatgaggagaacaat
tcggagcgggcctgtgacactctgctcatgtgcattgtcaccgtgctgaaccacgggctg
aggaacggtggaggggtgggagatgtgctacgcaagccctccaaaaacgagccactgttc
ccagcccgcgtcatctacgatctcctcttctacttcattgtcatcatcatcgtactcaac
ttgatctttggtgtcatcatcgacaccttcgctgacttgcgtagtgagaaacagaagaaa
gaggaggtcctcaagaccacctgcttcatctgtggtctggagagggacaagtttgacaat
aaaacggtgtcttttgaggaacacataaagttggagcacaacatctggaactacctgtat
ttcatcgtgcttgttcgtgagaagaacaagactgactacacaggtccagagagttatgtg
gccctcatgataaagagtaagaacctggactggttcccccgcatgcaggccatgtccctg
gtggtgacggatggagacggggagcagaatgaaatgaggaacctgcaggacagactgacg
tccactatgaacgtggtcagccaactcacaggacagttaacagagctcaaagaacagatg
acggagcagaggaagaggaggcagaggatgggcttcgtggatgtccagtcaggaggagct
ggtgcagctagtgtaacccccagtgctgctggaggaaaccaccagatgttcaacaaaccc
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254359
Entry
112254359         CDS       T05605                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1-like isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112254359
   04020 Calcium signaling pathway
    112254359
   04070 Phosphatidylinositol signaling system
    112254359
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112254359
  09143 Cell growth and death
   04114 Oocyte meiosis
    112254359
   04210 Apoptosis
    112254359
   04218 Cellular senescence
    112254359
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112254359
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112254359
   04625 C-type lectin receptor signaling pathway
    112254359
  09152 Endocrine system
   04912 GnRH signaling pathway
    112254359
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112254359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112254359
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112254359
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112254359
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112254359
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 112254359
NCBI-ProteinID: XP_024282615
LinkDB
Position
7
AA seq 2787 aa
MSDKMSSFLHIGDICSLYAEGSTSGFISTLGLVDDRCVVQPDTGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNESENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSLGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKVVLFMKWSDNKETILKGGDVV
RLFHAEQEKFLTCDDFKKKEYVFLRTTGRQSATSATSSKALWEVEVVHHDPCRGGAGYWN
SLFRFKHLATGSYLAAEVNPDYKEECPEPRSSVVDSVPFNFQLDSDHEALRARLRTPQER
VMYQLVSVPDGMDISSIFELDPTTLRGGDSLVPRNSFVRLRHLCTNTWVHSTNNPIDKEE
EKPVMLRIGTSAVKEDKEAFAIVPVPPAEVRDLDLANDASKVLASIAGKLEKGTITQNER
RFVTKLLEDLVFFVCDIPNTGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDS
GDGPMLRLEELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVL
AEDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSDLCVSMNKSIPVTQE
LICNAVLDPSNADILIETKLVLSRFEIEAVTMGENPIETEEDEEEVWLFWRDNCKEIRSK
SVRELAQDAKEGQKEDQEVVSYYRYQLNLFARMCLDRQYLAINKISGQLDVDLILRCMSD
EDLPYDLRASFCRMMLHMHVDRDPQEQVTPVKYARLWSEIPSKIAIDNYDNDGTTRDEIK
ERFCLTMEFVENYLMSVVSQNIPFDDREKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKI
LLNILDCVHVSTIYPITKLEKGEEKQGSNVMKSIHGVGELMTQVVLRGGGFLPITPTHQP
EEGVVKTQTEPEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNPQGD
NTSSSASQDGNNMTGALDFENIEEQAEAIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHD
YPPLVSGALQLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSIVEKSEL
WVYKRQGDDDGGDGPSESDHKKKGDSGSSDKKKEESNSSYNYRVMKEILLRLSKLCVQEG
ASGKKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQEIMKLAHEFLQNFCAGNQQN
QILLHKHINLFLNPGILEAVTMQHVFMNNFQLCSEINERVVQHFIHCTETHGRHVQYLKF
LQTIVKAENKFIKKCQDTVMAELVNSGEDVLVFYNDRASFQTLVTMMRSERDRMDENSAL
RYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV
DTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTVLEGYVTETVMSIVTTFFS
SPFSDQSTSLQTRQPVFVQLLQGVFRVYHCNWLNPTQKASVEACIKVLSDVAKSRAIAIP
VDLDSQVNNLFVKSNNVVTKSILSWRLSAKNAPRRDSNATASVSYRNIIERLQDIVSALE
DRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFISKLIKHTKQLLEENEERLC
IKVLQTLREMMTKDRGYGEKHIAFDDEMDVAELAPLPAEPEVPAADELDPNQPQKQLEDQ
RRGEALRQILVNRYYGNIKPGARRDSVTTFSNGPVPPGTEGKPRAVVSSGAAAAQGELTL
HEVQCRLDKEGASDLVIDLIMNATSDRIFQESILLAIALLEGGNTVIQKSFFMRLTGENK
SEMFFKVFYERMKLAQQEIKATVTVNTSDLGSKKKEEEPPDKDTPTAKGKKGMEVAVVST
VAVAVVTEEVKEQLAEASTVTKKAFTRYRREAEAEEHLAAAEGQGPASTPDDQEGEMSVI
ITIMQPILRLMQLLCENHNRELQNFLRCQNNKNNYNLVCETLQFLDCICGSTTGGLGLLG
LYINEKNVGLINQTVESLTEYCQGPCHENQNCIATHECNGIDIIIALILNDINPLGKKRM
DLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEPNEPAEE
DEDGEEEHAASPQNVGHNIYILAHQLARHNKELQALLKTYGEGDEALEFYAKHTAQIEIV
RLDRTMEQIVFPVPNICEFLTNESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKK
LRGTQEPTTGNANTVPSQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGIRGGTL
DGHLSALLWIAMLVSLAIVIILPQPHGVRVLIASTILRLIFSVGLEPTLFLLGAFNVGNK
MIFLMSFVGNRGTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLVYREE
TLLNVIKSVTRNGRSILLTAVLALILVYLFSIVGYIFFQDDFLLNIDRIPNKTLESGASM
VGEFLSAEVCRKDSGENCSTEAVVDAAIATQPSAVVIEDKERSCDSLLMCIVTVLSHGLR
SGGGVGDVLRKPSKEEPLFAGRVIYDLLFFFLVIIIVLNLIFGVIIDTFADLRSEKQKKE
EVLKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEYTGPESYVA
EMIREHNLDWFPRMRAMSLVCSDADGEQNEIRSLQEKLESTMKLVSNLSGQLTELKEQMT
EQRKQKQRIGLLGHPQHPQHANPQQPA
NT seq 8364 nt   +upstreamnt  +downstreamnt
atgtcggacaagatgtccagtttcctccacataggcgacatctgctccctctatgcggag
ggctccaccagtggatttatcagcactttagggcttgtggatgaccgctgtgtggtacag
ccagacacaggcgaccttaacaacccacccaagaaatttcgagactgccttttcaagctg
tgccccatgaacaggtactctgcacagaaacagttctggaaggcagcaaaaccaggggga
aacagcaccactgacacagtactactgaacaaactccaccatgctgctgatctggagaag
aaacagaatgaatctgagaaccgaaagctgctaggaactgtaatccaatacggaaatgtc
attcagctgttgcacttgaaaagtaataagtacctgacggtgaataagcgactccctgcc
ctgttggagaagaatgctatgagggtgacgctggactctgcaggcaacgagggctcctgg
ttttacattcagcccttctacaaactgcgctccctgggagacagtgtggtgattggagac
aaggtggtccttaaccctgtgaacgctggacagccccttcacgccagcagccatcagctg
gtcgacaacccaggatgcaatgaggtgaactctgtaaactgcaacacaagttggaaagta
gttttgttcatgaaatggagtgacaacaaggagactattcttaaagggggtgatgttgtt
cggctgttccatgcagagcaggagaagttcctgacatgtgacgacttcaagaagaaggag
tacgtctttctcaggactacaggacgccagtccgccacctccgccactagcagcaaggca
ttgtgggaagtggaggtggtccaccatgacccttgtcggggcggagctggctactggaac
agcctgttccggttcaaacaccttgcaacaggatcatacctggctgctgaggtgaacccc
gactataaggaagaatgtcctgagcccagatcctcagtggtggattctgttccctttaac
ttccagttggactcggaccatgaggccctgagagcgcgtttgcgaaccccccaggaaagg
gtcatgtaccaactggtgtctgttcctgatggcatggacatctcctccatctttgagctg
gaccctaccaccctgagaggtggggactccctagtgcccaggaactcttttgtgaggctc
aggcacctctgcaccaacacatgggtccacagcaccaacaaccccattgacaaggaggag
gagaagcctgtcatgttacggattggcacatcagcggttaaggaagacaaagaggccttt
gccatagtgcctgtccccccagcggaagtcagagacttagacttggccaacgatgccagt
aaagtgttggcatccattgctgggaaactggagaagggcactataacacagaatgagagg
aggtttgtcactaagcttctggaggacctggtcttcttcgtgtgtgacatccccaacact
ggccaggatgtgctggagatcatggtcaacaagcccaacagagagagacagaaactcatg
agggagcagaacatcctcaaacagattttcaaacttctccaagccccgttcacggacagt
ggggatggtcctatgctgcgattggaagagcttggtgaccagcgccacgcccccttcagg
cacatctgcaggctctgttaccgggtattacgacactcccaacaagactacaggaagaac
caggagtacatagccaagcagttccgcttcatgcagaagcagataggctacgacgttctg
gctgaggacacgataactgccctgctccacaacaaccgcaagcttctggaaaaacacatc
acggccgcagagatcgacacctttgtcaccctggtcaggaagaaccgggagcccaggttt
ctggactacctgtctgatctgtgtgtgtccatgaacaagtccatcccagtgactcaggag
ctcatctgtaacgccgtgctggacccatccaacgcagacatcctcatcgagactaagcta
gttctgtcgcgctttgagattgaggcagtaacaatgggggagaatcccatagagacagag
gaggacgaggaggaggtgtggctcttctggagggacaactgcaaggagatcaggagcaag
agtgtcagagagttggcccaggacgccaaggagggccagaaggaggaccaggaggtggtc
agctactacaggtaccagctgaatctgtttgcgcggatgtgtctggaccgtcagtacctg
gccatcaataagatctctggccagctagacgtggacctgatcctgcgctgcatgtctgac
gaggacctgccctatgaccttagggcatccttctgccgcatgatgctgcacatgcacgtg
gaccgcgacccccaggaacaggtcacgccagtcaagtacgcacgcctctggtccgagatc
ccctccaagatcgccattgacaactacgacaatgatgggaccaccagagatgagatcaag
gaaaggttctgcctgaccatggagtttgtggagaactacctgatgtctgtggtgtctcag
aacatccctttcgacgacagagagaaaaacaagctcaccttcgaggtagtgaacctggca
aggaacctcatttactttggcttctataacttcagtgacctgctgcgactgactaagatc
ttattgaacatcttggattgtgttcatgtcagcaccatttaccccattaccaagctggag
aagggagaggaaaaacaaggcagtaatgtgatgaagtctatccatggggtgggggagcta
atgacccaggtggtccttcgaggggggggcttcctccccatcacccccacccaccagccg
gaggagggtgtggtcaagacccaaacagagccggagagggaggacatcatggtgatggac
accaagctcaagatcatcgagatcctgcagttcattctgaatgtgcggctggactacagg
atctcctgcctgctctgcatcttcaagcgagagtttgatgagagtaaccctcagggtgat
aatacatcgtctagtgctagtcaagatggaaataatatgacaggggctctagattttgag
aacatagaagagcaggcagaggcaatctttggaggaagtgaggagaacacccctctggac
ctggatgaccatggagggaggaccttcctgagggtgctactgcacctcaccatgcatgac
taccctcccctggtgtctggggccctccagctgctcttcagacacttcagccagagacag
gaagtcctcatggctttcaaacaggtccagctcttggtgaccagtcaagatgtggacaac
tacaaacagatcaagtcggacttggaccagctgcgctccatcgtggagaagtcggagctg
tgggtgtacaagaggcagggggacgatgacggaggggacggaccctcagagtccgaccat
aaaaagaagggggattcaggcagctctgacaaaaagaaggaggaaagcaacagcagttac
aactacagggttatgaaggagatcctgctgcggctcagtaagctgtgtgtccaggaggga
gcatcggggaagaagagtaagaagcagcaacagagactattgaggaacatgggggcccac
agtgtggtgctggagctactgcagatcccctatgagaagggcgaggacgtccgtatgcag
gagatcatgaagctggctcatgagttcctccagaacttctgtgcagggaaccagcagaac
cagatcctgctgcataagcacatcaacctattcctcaacccagggattctggaggcagtc
accatgcagcacgttttcatgaataacttccagctgtgcagtgagatcaacgagcgcgtg
gtgcagcactttatccactgcaccgagacgcatggccgccatgtccagtacctcaaattc
cttcaaaccattgtcaaagccgaaaacaagttcatcaagaagtgtcaggacaccgtcatg
gctgagctggtgaactcgggcgaggacgtcctggtgttctacaacgaccgtgcgtccttc
cagaccctggtcacgatgatgcggtcggagcgggatcgtatggatgagaacagcgctctg
aggtaccacatccacctggtagagctgctggctgtctgcaccgagggaaaaaacgtctac
actgagatcaagtgtaactctctgctgcctttggatgacatagtgagggtggtcacccat
gaggactgcatccctgaggtgaagatagcctacatcaacttcctgaaccattgctacgtg
gacacagaggtagagatgaaggagatctacaccagcaaccacatgtggaagctctttgag
aacttcctggtggacatatgcagggtgtgcaacaacaccagtgacaggaagcatgcagac
acggttctggagggttacgtgacagagaccgtcatgagcatcgtcaccaccttcttcagc
tcgcccttctctgaccagagcaccagtctgcagactcgtcagccggtgtttgtacagctc
ctgcagggggtgttcagggtataccactgcaactggctcaaccccactcagaaggcctcc
gttgaggcctgtatcaaggtgctctctgacgtggccaagagcagagccatcgcgatccca
gtggacctggacagccaggtgaacaacctgtttgtcaagtccaacaacgtggtcaccaag
tccatcttgagctggagactctccgccaagaacgcccccaggagggactccaacgccact
gcgtccgttagctacaggaacatcatagaaaggctgcaggacatagtgtcagctctagag
gaccgtctgcgtcctttggtccaggctgagctatctgtcctggtggatgtgctgcatcgc
ccagagctactctttcctgagaacacagatgcccgcaggaagtgtgaaagcggtggcttc
atttccaagctgatcaaacacacaaagcagctactggaggagaacgaggagcggctgtgt
atcaaggtgctgcagactctgagggagatgatgaccaaagaccgtggctatggggagaag
cacattgcctttgatgatgagatggatgtggctgagctggcccctctgccggctgaacct
gaagtccctgctgcagatgagcttgatcccaaccagccccagaagcaactggaggaccag
agaaggggtgaagctctgaggcagattctggtgaatcgttactatgggaacatcaaacct
ggggccagaagagacagtgtgacgacgttcagcaatggtcctgtcccccctggaacagaa
gggaaacctcgagcagtggtgagttcaggggcggccgcggcccaaggggagctgaccctg
catgaggtccagtgccgcctggataaagagggagcatccgacctggtaattgacctcatc
atgaacgccaccagcgatcgtatcttccaggaaagcatcctattagccatcgccctgctg
gagggcggtaacacggtcatccagaaatccttcttcatgcgcctgacgggggaaaacaag
tcggagatgttcttcaaggtgttctatgagaggatgaagctggcccagcaggagatcaag
gccactgtgaccgtcaacaccagcgatctgggcagcaaaaagaaagaagaggagcccccg
gacaaggacacgcccaccgctaaaggaaagaaagggatggaggtggcagtggtgtctacg
gtggcggttgccgtggtgacggaggaggtcaaggagcaactggcggaggcctccacagtc
actaagaaggcgttcacaaggtaccggcgtgaggctgaggccgaggagcatctggctgcc
gctgagggtcagggccccgccagcactccagacgaccaggaaggggagatgagtgtcatt
atcaccatcatgcagcccatcctgcgactcatgcagctgctgtgtgagaaccacaacagg
gagctgcagaacttcctacggtgtcagaacaacaagaacaactataatctggtgtgtgag
acactgcagttcctggactgtatctgtggcagcaccacgggaggcctggggctactggga
ctctacatcaatgagaagaacgtaggtctcatcaaccagacagtagagagcctcacagag
tactgccagggaccctgccatgagaaccagaactgcatcgccactcatgaatgcaacggt
atcgacatcatcatcgctctgatcctcaacgacatcaaccccctgggcaagaagaggatg
gacctggtgctggagcttaagaataatgcatccaagctcctcttggccatcatggagagt
cgccacgacagtgagaacgcagagaggatactatacaacatgaggcccaaagaactggtg
gaggtgataaaaaaggcctacatgcagggggaggtggagccaaatgagcctgctgaggaa
gatgaagatggcgaggaagagcatgcagcctctccacaaaacgtgggccataacatctac
atcctggctcatcagttggcccgccacaacaaggagctgcaggccttgttgaagacctat
ggggagggggatgaagccctggaattctatgccaagcacacagctcagattgagattgtg
cggctggatcgcaccatggagcagatagtcttccccgtgcccaacatctgtgagttcctc
accaacgagtccaagctgcgggtgtactataccacggagcgcgatgagcagggcagcaag
atcaacgacttcttcctgcgctctgaggacctcttcaacgagatgaactggcagaagaag
ctgcgaggtactcaagagccaaccactggtaacgcaaacacggttccctcccagcccatt
ctatactggtgttctcgtaacatgtccttctggagcagcatctccttcaacctggctgtg
ctcatgaacctgctggtggccttcttctaccctctggaaggaatccgcggaggtaccctg
gatggtcacctgtcagctctgctgtggatcgccatgctggtttccctggccattgtcatc
atcctgccccagccccacggcgtccgggtcctcatcgcctcaaccatcctccgcctcatc
ttctctgtgggcctggagccaaccctcttcctcctgggggccttcaacgtgggcaataag
atgatcttcttgatgagtttcgtggggaacagagggacgttcacgcggggctacaaggcc
atgatcatggatgtcgagttcctctaccacctcctctacctgatcatctgtagtctgggc
gtcttcgtccatgtcttcttctacagtctgctgctctttgacctggtgtacagggaggag
acgctgctgaatgtgatcaagagtgtaacccgtaatggccgctccatcctgctgacagcc
gtgctggctctcatcctggtctacctcttctccatcgtgggctacatcttcttccaggat
gactttctccttaacattgacaggatacctaataaaacacttgagagtggagccagtatg
gtgggagagttcctatcagcagaagtgtgtcggaaggacagtggggagaactgctccaca
gaagctgttgtggatgctgccatagccacccaaccgtcggcagtagtgatcgaggacaag
gagcggtcatgtgactctctactcatgtgtattgtcactgtcttgagtcacggcctgagg
agtggaggtggtgtgggggacgtcctgcggaagccatccaaagaggagcctctgtttgct
ggcagggtgatctatgacctgctcttcttcttcctggtcatcatcatcgtcctcaacctc
atcttcggagtcatcatcgacacctttgccgacctcaggagtgaaaagcaaaaaaaagag
gaagtcctgaagacgacatgctttatctgcggcctggaaagggacaagtttgacaacaag
acagtgacatttgaagagcacatcaaggtggagcacaacatgtggcactacctgttcttc
atagtgctggtgaaggtgaaggactccacagagtacacaggaccagagagctacgtcgct
gagatgatcagggagcacaaccttgactggtttccacggatgcgggccatgtctctggtc
tgtagcgatgcggacggggagcaaaatgaaatcaggagcctacaggagaaactggagtct
accatgaagctagtctccaacctctctggacaactgactgagctcaaggagcagatgaca
gagcaaaggaagcagaaacagagaattggactgttgggccatcctcagcatcctcaacac
gccaacccccagcaacctgcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262812
Entry
112262812         CDS       T05605                                 

Gene name
itpr1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04020  Calcium signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112262812 (itpr1)
   04020 Calcium signaling pathway
    112262812 (itpr1)
   04070 Phosphatidylinositol signaling system
    112262812 (itpr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112262812 (itpr1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112262812 (itpr1)
   04210 Apoptosis
    112262812 (itpr1)
   04218 Cellular senescence
    112262812 (itpr1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112262812 (itpr1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112262812 (itpr1)
   04625 C-type lectin receptor signaling pathway
    112262812 (itpr1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112262812 (itpr1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112262812 (itpr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112262812 (itpr1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112262812 (itpr1)
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112262812 (itpr1)
Ion channels [BR:otw04040]
 Ligand-gated channels
  IP3 receptor
   112262812 (itpr1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 112262812
NCBI-ProteinID: XP_024294358
LinkDB
Position
2
AA seq 2758 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPDTGDLNNPPKKFRDCLFRL
CPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNDSENKKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVMLDTAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASTHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNQEIILKGGDVV
RLFHAEQEKFLTCDDHRKKQYVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEECLEFRSSLDSEQVDLRARLRNPQEKVMYTLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNHPIDKEEEKPVMLRIGT
SALKEDKEAFAIVPVSPAEVRDLDFANDASKVLASIAGKLEKGTITQNERRAVTKLLEDL
VFFVVDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEE
LADQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLDPI
NGDILIETKLVLSRFEIEGASIGENSVESEEDEEEVWLFWKDRSKEIRSKSIRELAQDAK
EGAKEDQEVVSYYRYQLNLFARMCLDRQYLAINKISGQLDVDLILRCMSDEDLPYDLRAS
FCRMMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDNDGTSKDEIKECFALTMEFV
ENYLRDVVCQSFPFADKEKNKLTFEVVNLSRNLIYFGFYNFSDLLRLTKILLAILDCVHV
STIFPINKLEKGDETKGSNVMRSIHGVGELMTQVVLRGGGFLPTTPINPPDGDQVKTQTE
PEKQDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSDLSIAGTHEGP
NNMPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSRALH
LLFRHFSQRQEVLQAFKQVQLLVTSKDVENYKQIKSDLDQLRSIVEKSELWVYKRQGPDE
GMDAGEGSAESQHKKGDSNSGGSDKPRKPESTRSYNYRVVKEILLRLSRLCVQEGLSGRK
SKKQQQRLLRNMGAHTVVLELLQIPYEKGEDVRMQEIMKLAHQFLQNFCAGNQQNQALLH
KHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYLKFLQTIV
KAESKFIKKCQDIVMAELVNAGEDVLVFYNDRASFQTLVTMMRSERDRMDQNSPLMYHIH
LVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVE
MKEIYTSNHMWKLFENFLVDICRVSNNTSDRKHADTVLESYVTETVMSIVTTFFSSPFSD
QSTSLQTRQPVFVQQLQAVFRVYHCNWLVPVQKGSVESCIKVLSDVAKGRAIAIPVDLDS
QVNNLFVKSNNIVQKTAMSWRMSARNAARRDSVLTTSRDYRNIIERLQDIVSALEDRLRP
LVQAELSVLVDVLHRPELLFPENTDSRRKCESGGFICKLIKHTKQLLEENEERLCIKVLQ
TLREMMTKDRGYGEKLRAFDDEMDMPELDLNQPQKILDDQRRGEALRQILVNRYYGNFHS
RSGGRRDSLTAFSNGTLVPVGPSKSQSGLGGPGALSRGEMSLAEVQCHLDKEGASDLVID
LIMNTTSDRVFQESILLAIALLEGGNTTIQRSFFCRLTEDKKSEKFFRVFYDRMKLAQLE
IKATVTVNTSDLGNRKRDDDAPDKEVPIRKKAKDSAVVVTEEAREQLLEASSATKKAFNS
YRREADPEDHFSAADGTPSAGDKSQEDGEMSFIIVIMQPILRFLQLLCENHNRDLQNFLR
CQNNKNNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTVESLTEYCQGPCH
ENQNCIATHESNGIDIIIALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSENA
ERILYNMRPRSLVDVIKKAYLQGEVEFEDPEEDDDSGEEEEHDAASPRNVGHNIYILAHQ
LARHNKELQVMLKPGGTNGEGDEALEFYAKHTAQIEIVRHDRTMEEIVFPVPNICEFLTC
ESKLRVYYTTERDEQGSKINDFFLSAEDLFNEMNWQKKLRAQPVLYWCSRNMSFWSNISF
NLAVLMNLLVAFFYPLEGLREGTLEPHLSALLWVGMLALLAIVVAMPQPLGVRTLIIATI
IRLIFSVGLQPTLFLLGAFNVCNKTIFLMSFVGNRGTFTRGYKAMILDVEFLYHLMYLII
CSLGVFVHVFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYI
FFKDDFILEVDRIPNTTLENGASLANEMVSAGMCRSETGENNCTTELQVEDFVEDREDGK
ERTCDSLLMCIVTVLSHGLRSGGGVGDVLRKPSKEVNRQTRHPPSRGRPLFAARVIYDLL
FFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHI
KEEHNMWHYLFFIVLVKVKDSTEYTGPESYVAEMIKEHNLDWFPRMRAMSLVSSDAEGEQ
NEIRNLQEKLESAMRLVCNLSGQLTELKEQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8277 nt   +upstreamnt  +downstreamnt
atgtcggataagatgtccagtttcctacacatcggggacatctgctccctgtatgcagag
ggctccaccaacggctttatcagcactctggggctggtagatgaccgctgtgtggtacag
cccgacacaggggaccttaacaaccccccaaaaaagttcagagactgtctgttcaggttg
tgtccaatgaatcggtactctgctcagaaacagttctggaaggcagcgaaacctggagga
aacagcaccacagacacggttctcctcaacaaactccatcatgcagcggatttggaaaag
aagcaaaacgattcggaaaataaaaagttgcttggaacggtgattcagtatgggaacgtc
attcagctcctccatttgaagagtaacaagtacttgactgtgaacaagcgtctgccagcg
ctgctggagaagaacgccatgagagtgatgctggacacggccgggaacgaaggctcctgg
ttctacattcaacccttctacaagttgcgctccataggagacagtgtggtgataggggac
aaagtggtcctgaacccagtgaatgctggccagcccctacatgccagcacccatcagctg
gtggacaacccaggctgtaacgaggtgaactcggtcaactgtaacaccagctggaagatc
gtgctgttcatgaaatggagtgacaatcaggagatcattctaaaagggggcgacgtggtg
cgcctgttccatgcggaacaggagaagttcctcacctgtgacgaccaccgtaaaaaacaa
tatgtcttcctgcgcaccaccggacgccagtcggctacctctgcaaccagcagcaaagcc
ttatgggaggtggaggtggtgcagcatgatccatgtcgaggcggagctggctactggaac
agtctgttcaggttcaaacacctggccactggacactatctggctgcagaggtgaaccct
gactatgaggaggagtgcctggagttccgttcctcactggactctgagcaggtcgacctc
cgcgcccgcctcaggaacccccaggagaaagtcatgtataccctggtgtctgtccctgaa
ggcaatgacatctcctccatttttgagctggaccctaccactttgagagggggggactcc
ctggtgcccaggaactcgtatgtgaggctcagacacttgtgcaccaacacatgggtccac
agcactaaccaccccatcgacaaggaagaggagaaaccggtcatgttacgtatcggcaca
tcagcactgaaagaagacaaagaggcgtttgccatcgtacccgtctcgcccgctgaagtc
cgagatcttgactttgccaatgatgccagtaaagtgttggcgtccatcgcaggcaaactg
gagaagggcaccatcactcagaacgagaggagggcagtgaccaagcttctggaggacctg
gtgttcttcgtggtggacatccccaataatggccaagatgttttggaaatcatggtcaac
aagcccaaccgagagagacagaaactcatgagggaacagaatatcctcaaacagatcttc
aagctactgcaggctccattcacagacagtggggatgggcccatgctgcgattggaggag
ctggctgaccagcgccacgcccccttcaggcacatctgccgcctgtgttaccgtgtgtta
cgccactcccaacaggactaccgcaagaaccaggagtatatagccaagcagttccgcttc
atgcagaagcagataggttatgatgttctggctgaggacactatcacagctctgctccac
aacaaccgcaagctgctggagaaacacatcaccgctgcagagatagacacctttgtcagc
ctcgtcaggaagaaccgggagcccaggttcctggactatctgtcagacctgtgtgtgtct
atgaacaaatccatcccggtgacacaggagctcatctgtaacgcagtcctggaccccatc
aacggagacatccttatagagaccaaactggtgctgtccaggtttgagatcgagggagcg
tccatcggggagaattcagtggagtctgaggaggacgaggaggaggtgtggttgttctgg
aaggaccgtagtaaggagatcagaagtaagagcatcagagagctggcccaagatgccaag
gagggcgccaaggaggaccaagaggtggtcagctactacaggtaccagctgaacctgttt
gcgaggatgtgtctggaccgtcagtatctggccatcaataagatctctggccagttggac
gtggatctgatcctgcgctgcatgtctgacgaggatctgccttacgacctgcgcgcctcc
ttctgccgcatgatgctgcacatgcacgtggaccgcgacccccaggaacaggtcacgccc
gtcaagtacgcccgcctctggtccgagatcccctccgagatcgccattgacgactatgac
aatgacgggacgtccaaggatgagatcaaggagtgttttgccctgaccatggagtttgtc
gagaactatcttagagacgtggtgtgtcagagcttcccattcgccgacaaggagaagaac
aaactcaccttcgaggtagtgaatctatctaggaacctcatctactttggcttctacaac
ttcagtgacttgctgaggctgaccaagatcctgctggccatcctggactgtgtccacgtc
agcaccattttccccatcaacaagctggaaaagggagacgagactaaaggcagtaacgtg
atgcgctccatccacggggtgggggagctgatgactcaggtggtgctcagaggagggggg
ttcctgcccaccacccccatcaacccacccgacggggaccaggtcaagacccagacagag
ccagagaaacaggacatcctggtcatggacaccaagctcaagatcatagagatactacag
ttcattctgaatgtgcgtctggactaccggatctcctgtttgctgtgtatctttaagagg
gagtttgatgagagcaactcccagtcagatctgtctatagcaggaacccatgagggacca
aacaacatgccaggagctctggactttgagcacatagaggagcaggcagaagggatattt
ggtggaagtgaggagaacaccccgttagacctggatgaccacggtggtaggaccttcctg
agggtccttctccacctgaccatgcacgattaccctcccctggtgtcccgagccctccac
ctgctcttcagacacttcagtcagagacaggaggtcctacaggccttcaaacaggtccag
ttgctggtgaccagtaaggatgtagagaactacaagcagatcaagtcagacctggaccag
ctacgctccattgtggagaagtctgagctgtgggtctacaagagacaggggccagatgag
ggcatggacgctggggagggctctgcagagtctcaacacaagaagggtgactccaactcg
ggtggctcagacaagccaaggaaaccagagagcaccaggagctacaactacagagtggtg
aaggagattctgctgcgtctcagcaggctatgtgttcaggagggtctgtcaggcaggaag
agtaagaagcagcagcagagactcctcaggaacatgggagctcacaccgtggtgctggag
ctactacagatcccctacgagaagggggaggatgtgcgcatgcaggagatcatgaagctg
gcccaccaattcctgcagaacttctgtgcagggaaccagcagaaccaggctctgctccac
aaacacatcaacttgttcctcaatccagggatcctagaggctgtcaccatgcaacatatc
ttcatgaataacttccagctgtgcagtgagatcaacgagcgcgtggtacagcactttgtc
cactgcatcgagacgcacggccgcaacgtccagtacctcaagttcttgcagaccatcgtc
aaggccgagagcaagttcatcaaaaagtgtcaagacatcgtcatggctgagctggtgaat
gctggcgaggacgtgctggtgttctacaacgaccgtgcgtccttccagaccctggtcacg
atgatgcggtcggagcgagaccgtatggatcagaacagtcctctgatgtaccacatccac
ctggtagagctgctggctgtctgcactgagggaaagaacgtctacactgagatcaaatgt
aactctctgctgcctctggacgacatagtgagggtggtcacccacgaggactgtatccct
gaggtgaagatagcctacatcaacttcctgaaccactgctacgtggacacggaggtggag
atgaaggagatctacaccagcaaccacatgtggaagctctttgagaacttcctggtagac
atctgtagggtgtccaacaacacgagtgaccgcaaacatgccgacacggtcttggagagc
tatgtgaccgagacagtcatgagcatcgtgaccaccttcttcagctcacccttctccgac
cagagcaccagcctgcagaccaggcagccagtgtttgtacagcagttacaggcagtgttc
agagtgtaccactgtaactggttggtcccagtccagaagggttcagtggagagctgtatc
aaggtgctgtctgacgtggctaaagggcgagccatagccatcccagtggatctggacagc
caggtgaacaacctgtttgtgaagtccaacaacatcgttcagaagacagccatgtcctgg
agaatgtctgcccgtaacgctgcacgcagagactcagtactgaccacctcccgagactac
aggaacatcatcgagagacttcaggacatagtgtcagctctagaagaccgcctgcgtccg
ttggtccaggctgagctgtctgtcctagtggatgtactgcatcggcccgagctactcttc
cctgagaacactgactcccgcaggaagtgtgagagtggcggtttcatctgcaagctgatc
aaacacaccaagcagcttctggaggagaatgaagagaggctgtgtatcaaggtcctgcag
accctccgagagatgatgaccaaagacagaggatatggagagaagctcagggcctttgat
gatgagatggatatgcctgagctggatctcaaccagccacagaaaatactggatgaccag
aggaggggtgaggcgttgaggcagattctggtgaaccgttactatggcaacttccatagt
aggagtggtgggcggagggacagcctgactgccttcagcaacggaaccctggttccagta
gggcccagcaagagccaatcaggtctaggtggaccgggagccctgagtcgaggggagatg
agcctggcagaggtgcagtgtcacctggacaaggagggcgcctccgacctggtcatcgac
ctcatcatgaacaccaccagtgaccgtgtctttcaggagagcatcctattggccatcgcc
ctgctggagggtgggaacaccaccatccaacgttccttcttctgccgtctgacggaggac
aagaagtctgagaagtttttccgggtattctacgaccggatgaagctggcccagctggag
atcaaagccactgtgacagtcaacaccagcgacctcggcaacagaaagagggacgacgac
gcccccgacaaggaagtgcccatccgcaagaaagccaaagactcagcggtggtggtgaca
gaggaagcgagagagcagctgctggaggcatcgtcggccactaagaaagccttcaactcg
taccgccgtgaggctgacccagaggaccacttctcggcggcagacggcacgcccagcgcc
ggggacaagagccaggaagatggagagatgagcttcatcattgtcatcatgcagcctatc
ctgcgcttcctccagctgctctgtgagaaccacaaccgagacctgcagaactttctgcgg
tgtcagaacaataagaacaactataatctggtgtgtgagacgctgcagttcctggactgt
atctgtggcagcaccacgggaggcctgggtctactgggcctctacatcaatgagaagaac
gtggctctcatcaaccagacagtggagagcctgaccgagtactgccaaggaccctgccac
gagaaccagaactgcatcgccacccatgagtccaatggcattgacatcatcatcgccctg
atactgaatgacatcaacccactggggaagaagaggatggacctggtgcttgaactcaag
aacaatgcctccaaattgttgttggctatcatggagagtcgccatgacagtgagaatgct
gagagaatcctgtacaacatgagacctaggagccttgtggatgtgatcaagaaggcctac
ctgcagggagaggtggagtttgaggatcccgaagaggatgacgacagcggggaggaggag
gagcatgatgctgcctcccccaggaacgtgggccacaacatctacatcttggcccaccag
ttggcacgccacaacaaggagctgcaggtgatgctgaaaccaggagggaccaacggagag
ggagacgaggctctggagttctacgccaaacacactgctcagatagagattgtgcgtcat
gaccgaaccatggaggagatagtgttccctgtgcccaacatctgtgagttcctgacctgt
gagtccaaactgagggtgtactacaccactgagagggacgagcagggcagcaagatcaat
gacttcttccttagcgcagaggacctcttcaatgagatgaactggcagaagaaactaaga
gcccagcctgtgttgtactggtgttccagaaacatgtcattctggagtaacatctccttc
aacctggccgttctcatgaacctcctggtggccttcttctaccccctggagggtttgcgt
gaaggtaccctggagccccacctgtctgccctgctctgggtgggcatgttggcattgttg
gccatcgtggtggccatgccccagcccctgggggtccgaaccctcatcatcgccaccatc
atccgcctcatcttctccgtgggcctgcagcccaccctgtttctgctgggagcattcaac
gtgtgtaataagaccatcttcctgatgagttttgtggggaacagagggacgttcacacgg
ggctacaaggccatgatcctggacgttgagttcctctaccacctkatgtacctcatcatc
tgtagcctgggggtctttgtccatgtcttcttctacagcctactgctctttgacctggtg
tacagggaggagactctactgaacgtgataaagagtgtgacccgtaacggtcgctccatc
gtgctgacagcagtgctggccctcatcctggtctacctgttctccatcgtggggtacatc
ttcttcaaggatgacttcatcctggaggtggatcgcatccccaacaccaccctggagaac
ggagccagtttggccaatgagatggtgtctgctgggatgtgtcggtctgagactggagag
aacaactgcaccacagagctccaagtggaagactttgtggaggacagggaggatggcaag
gagcgtacgtgtgactctctgctcatgtgtatcgtcactgtgctgagccatggcctgagg
agtggagggggggttggagacgtcctgagaaagccctccaaagaggtaaacagacagacc
agacacccacccagtcgggggaggcctctctttgcggccagggtgatttacgacctgctc
ttcttctttatggtcatcatcattgtcctcaacctcatcttcggagtcatcatcgatacc
tttgcagacctgaggagtgagaaacagaagaaggaagaggtcttgaagaccacctgcttc
atctgtggtctggagagagacaagtttgacaacaagacggtgacatttgaggagcacatc
aaggaggagcacaacatgtggcactacctgttcttcatagtgctggtcaaggtgaaggac
tccacagagtacaccggccccgagagctacgtcgcagagatgatcaaggagcacaacctg
gactggttcccgcggatgcgtgcaatgtcgctggtgagcagtgatgccgagggcgagcag
aacgagatcaggaacctgcaggagaagctggagtcggccatgaggctggtgtgtaacctg
tctggacagctcacggaactcaaggagcagatgacagagcagaggaaacagaagcagagg
attgggctcctgggccacccccctcacatgaacgttaacccccagcagccagcctga

DBGET integrated database retrieval system