KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218825
Entry
112218825         CDS       T05605                                 

Definition
(RefSeq) retinoblastoma-like protein 2 isoform X1
  KO
K16332  retinoblastoma-like protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112218825
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112218825
   04218 Cellular senescence
    112218825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112218825
Transcription factors [BR:otw03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    112218825
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 112218825
NCBI-ProteinID: XP_024235791
LinkDB
Position
19
AA seq 1092 aa
MNEEEDFLQKIRLGFEELCRALNMDVEASNEAWRSYESIRKKYTLEGSDLHWLACAIYVA
CRTPVPTVDKGTAEGNYVSLTRILRCSEQSLIEFFNKIKKWQDMASLPQDFRHSTEKLER
NFTVSAVIFKKYVPIFKAIFKAPSDEPPRVHRSRKQRCHPCTVAEVFNFCWILFVHAKGN
FPMISDDLVNSYHLLLCALDLIFSNALLCNARKELLNPNFKGLPEDFSSKDYKPTAGPYC
FIEQLCELHDGLVLEAKGVKEHFWKPFIRRLFHKKILKGKEESLTGFLDPMNFGDSSVSI
GRVYEEHVLATGGLDDRIFLGEGTPGPCLCEGAENQDASAYRLYNSQTASVLKVSTSFTG
RNYVQDNSLCMPVSTAMQSVGRLHSLLTGLKRGPSRRLTDLLRSCARDPSEVISTRLKDM
CQLFCQHYEGNWEENAGLGKDIAVYFCMAEALYYKTLEAVIDQEKKRLGNLDLSGILEQD
VFQRSLLACCLEIVIFSYRPPGDFPRIIHIFQLPAYHFYKVIEVLVRVEQGLFRKVVKHL
NQVEEQVLESLAWRGGSPLWDSVRGAKNQPPSCQEVMPPQHLEDGDGAAPLTPSNRGTDL
GANRGGKGVSTSTTTMLDRYSCPTTGSARRRLFVDVSCDAPSDPSTTNLTTNLRTSQAIP
AGQTVVTMATATVTTNNGQTVTIPVQGIANENGGITFIPVKVSVTGQGTLQPLSAQSLTG
TLTSQPQTTTLKSPTLQGSHAAGKPIEKPAAQGPSNNGPQKKSSLSLFFRKVYHLASVRL
RDMCAKLDISSELRRKIWTCFEYSLVHYTELMMDRHLDQLLMCAVYVMTKVTKEDKSFQN
IMKCYRSQPQASSSVYRSVLISGRKRRHSGSSERNGQSSPTETSHEGSGDSSPVPMRSTS
TLPTPQPGSTPSTPTLAPSTFLSTSSSLPPSQQQDDEGGVVVGGRVEERGDLIHFYNRVY
IKQMRHFALRYSPSSSSAGLESPPLCLYPSLRTSSPRRVLLSHNHSIYISPHKASDSPPT
ATAQDKIFYYICSGPANRLAEINSMIRTGETPTKKRSMQLEEEPSPKRLCPDNQTALFRR
LQDVANDRSSSH
NT seq 3279 nt   +upstreamnt  +downstreamnt
atgaacgaggaggaagactttttgcagaaaataaggctggggtttgaagaactctgtcga
gctttgaatatggacgtggaggcgagcaacgaagcatggaggagttacgaaagcataaga
aaaaaatacacattagagggcagtgacctacactggctggcctgtgccatttatgtggcc
tgtagaacaccagtaccaacagtggataagggtactgcagaaggaaactacgtctccctg
acccgaatactccgctgttcagaacaaagcctcattgagttcttcaacaagataaagaaa
tggcaggatatggccagtcttcctcaggacttccgccacagcacggagaagctggagaga
aatttcacagtttccgccgtcatcttcaagaaatacgtccccatcttcaaagccatcttt
aaggcgccctcggatgaaccgcccagagtccacaggagccgcaaacagagatgccatccc
tgcaccgttgctgaagtcttcaacttctgctggattctgtttgtccacgccaaaggaaac
ttccctatgatcagtgatgacctagtgaattcgtaccatctccttctgtgtgctctggac
ctgatcttctccaacgccctgctctgtaatgccaggaaggagctgctcaaccccaacttc
aaaggccttcctgaggacttcagcagtaaggactacaagcccactgcagggccttactgc
ttcatagagcagctgtgtgaactgcatgatggcctggtgctggaggccaaaggggtgaag
gaacacttctggaaacccttcatcaggaggctcttccataagaagattctcaaagggaaa
gaagagagcttgactggcttcttagatcctatgaattttggagacagttctgtgtccata
ggccgtgtgtatgaggagcatgttctggccactggaggtctggatgataggatctttttg
ggagagggcaccccaggcccctgtctctgtgagggagcggagaaccaggacgcctcagca
tacagactctacaacagtcagactgcctcagtcctgaaggtgtccacttcctttacgggt
cgtaattatgtccaggacaacagtctgtgtatgccggtctctactgccatgcagagtgtt
ggtcgactacacagcctgctcactggactgaagcgcggccccagccggagactcacagac
ttactgaggtcgtgtgccagagaccccagtgaggtcatctccactaggctgaaggacatg
tgtcagctcttctgccagcactatgagggcaactgggaagagaacgcaggactggggaaa
gacatcgcagtgtacttctgcatggcagaggcgctctactataaaaccctggaggccgtc
attgaccaggagaagaagagactgggcaacttggatctctctggtattctggaacaggat
gtgttccagcgctctctgctggcctgctgtctggagattgtcatcttctcctaccgaccc
ccaggggacttcccacgaatcatacacattttccagctccctgcataccatttttataag
gtgatcgaggtgctggtgcgggtggagcagggtctgttcaggaaggtggtgaagcatctg
aaccaggtggaggagcaggttctggagagcctggcctggagggggggatccccgctgtgg
gacagcgtcaggggggccaagaaccaaccaccctcctgccaggaggtgatgccaccacag
catctggaggatggggacggagccgcccctctcacccccagcaaccgtggcactgacctg
ggcgccaaccgtggtgggaaaggtgtgtccacctccaccaccaccatgttggaccgctac
agctgccccaccacgggctcggccaggagacggctgtttgtggatgtgtcctgcgacgcc
ccctcggacccctccaccaccaacctcactaccaacctcaggacctcccaggccatccct
gctggacagactgtggtcaccatggcaacggccacagttaccactaacaacggacagacg
gtcaccatacctgtgcaaggaatagccaatgagaacggaggcatcaccttcatccctgtc
aaggtaagtgtgacgggacaaggtacgctccagcccctgtctgcccagtccctgactggc
actttgaccagccaaccacagaccaccaccctgaaaagtcccactctccagggcagccac
gccgccggcaagccaatcgagaagccggcagcccagggcccgtccaataacgggcctcag
aaaaagagttccctctcgctgttcttccgcaaggtgtaccacctggccagtgtgcgtctc
agagacatgtgtgccaagctggacatctctagtgagctacggaggaagatctggacatgt
ttcgagtactctctggtgcactacacagagctcatgatggaccgacacctagaccagctc
ctcatgtgtgctgtgtacgtcatgaccaaggtgaccaaagaggacaagtccttccagaac
atcatgaagtgttaccgctctcagccccaggctagcagcagcgtctacaggagtgtgttg
atctctgggaggaagagacgtcactcaggaagcagtgagagaaatggacagagctctcct
acagagaccagccatgagggaagtggagacagcagccccgtacccatgcgttccaccagc
accctacccacccctcagcctggcagcaccccatccacccccaccctggccccctccacc
ttcctctctacatcctcatccctccctccctcccagcagcaggatgatgaagggggagtg
gtggtgggggggagggtggaggagcgaggagacctcatccacttctacaaccgggtctac
atcaaacagatgcgccactttgccctgcgctactcgcccagctcatcctctgcagggcta
gagtctcctcccctgtgcctgtacccctccctgaggaccagctcccctcgcagggtcctc
ctgtcccacaaccactccatctatatctccccccataaggctagtgacagcccccccacc
gctaccgcacaggacaagatattctactacatctgcagcggcccagccaaccgcctggcg
gagatcaacagtatgatccgcaccggggagacgcccaccaagaagcgcagtatgcagctg
gaggaggagccatctcccaagaggttgtgtccggacaaccagacagccctcttccgcagg
ctacaagacgtggccaacgatcgtagctcctcccactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249362
Entry
112249362         CDS       T05605                                 

Definition
(RefSeq) retinoblastoma-like protein 2 isoform X1
  KO
K16332  retinoblastoma-like protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112249362
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112249362
   04218 Cellular senescence
    112249362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112249362
Transcription factors [BR:otw03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    112249362
SSDB
Motif
Pfam: RB_A RB_B Baculo_gp64
Other DBs
NCBI-GeneID: 112249362
NCBI-ProteinID: XP_024274984
LinkDB
Position
4
AA seq 655 aa
MATQRHVPSDXLARTFRSCARNPSEVISTRLRDMRHTFIQHYQEPWEENHSLDRERGVKF
SSQTEALYYRVLEAVINQERKRLGYKDLSDILEHDLFQRSLVACCLEMVIFSHQPPGSFP
LVIDIFSLAPYDFYKVIELVLRAEEGLLPGVVRHLTHIEEQVLESLAWRRDSPLWDQIRA
AKGQGQLPAYHQVMLPQYSEDTDKMXKXPPXPSHLTPSLVNGIHGNDLNSPITHHEHYSS
PXAGSKTAACPATPVSPSQSSSVIVTGQTVVTMASATVTTNNDQSVTIPVRGIANDXGAI
TFTLSVVGQPIPPQQVSSTSTQQPQNPLPSTQSKGSISLFLRKVYHLVSMRLRDICVKLD
ICEALRLKIWTCVEHSLVHCTDLXLDRHLDQILMCAIYVMAKVTKVDMPFKLIMQCYKTQ
PQASNCVFRSVLISGRNTKTSQNSPGGSNRENIDVDPSSSLLTYQSPPTHPTGRRAPCRQ
DQEERGHLIYFYNTVYVKQMKDFALRYTSSSLTIAGVETPPLSPYPCQRIGSLRRLRPSN
HHSLYISPHKPSTHPSPRTGVLYIFSRSPSKSLREISDMMKTFQSRTRKCCAAQLQEDGE
EEGGPLAKRPCQDRPSNLQRKLRDFDQALMRAQNKQQAQTGAKAQHQATAHNGTH
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcaacccagagacatgtacccagtgacartctggctagaacattcaggtcctgtgcc
agaaaccctagtgaggtcatctccactagactgagagacatgcgccacaccttcatccag
cactaccaggaaccatgggaagagaaccacagcctagacagagagagaggagtgaagttc
tccagccagacagaggctttgtactacagggttctagaggctgtcatcaatcaggagagg
aagaggctgggatacaaagacctttcagacattctggagcatgatctgttccagcgctct
ctagtggcctgttgtctggagatggtaatcttctcccatcagccaccaggcagcttcccc
ctggtcattgacatctttagcctggcgccatacgacttctacaaggtgatagagctggtg
ctgcgggctgaggagggcttgttgccgggtgtggtcaggcatctgacccatatagaggag
caggtcctggagagtctggcctggaggagagactcaccactctgggaccagatcagagct
gctaagggtcagggacagctgcctgcataccatcaggtgatgctcccccaatactcagag
gacacagacaagatgrccaagrtccctcccamcccttcacacttgaccccaagccttgtg
aatgggatccatggaaatgacctgaactccccgattacccaccatgaacactacagctca
cccyctgctggctcaaagacggctgcttgccctgccaccccagtcagcccatcccagtcc
tcctctgtcattgttactggacagactgtagtcaccatggcatcagccactgtcaccacc
aacaatgaccagtcagtcaccataccggttcgaggcattgccaacgacyggggagccatc
acatttaccctcagtgttgtaggtcagcccattcctccacagcaagtctccagcacctct
acccagcagccccagaaccctctaccctctacccagagtaagggctccatctcactgttc
ctccgcaaggtctaccacctggtgagcatgcgtctgagggacatctgtgttaaactggac
atctgtgaggcgctgcggctgaagatctggacctgcgttgaacactccttggtccactgc
actgacctcatkctagaccgacacctggaccaaatactcatgtgtgccatctatgtcatg
gccaaggtaaccaaagtggacatgcccttcaagctcatcatgcagtgctacaagactcag
cctcaagcaagcaactgtgtattcagaagtgttctgatctcagggagaaacaccaagacc
tcacaaaactctcctggaggatccaacagagaaaacattgatgtagaccccagcagtagc
ttgcttacctaccagagccctcccacccatcctacaggacgcagagctccctgtagacag
gaccaggaggagagaggacacctcatctatttctacaacaccgtctatgtcaaacagatg
aaggactttgccttgcgctacacctccagctctctgaccatagccggggttgaaacccct
cccctttcgccatacccctgccagcgtattggatccttgcgcagactccgcccctccaac
caccattccctctacatctccccccacaagcccagcacacacccctccccccgcactggg
gtcctctacatcttcagcagaagcccctcaaagagtctgagagagatcagcgacatgatg
aagacatttcagtcacgcaccaggaagtgctgtgcagcccagctgcaggaggacggtgag
gaggagggtgggccgcttgcgaagagaccctgtcaggatagaccgtcaaacttgcagaga
aagctcagggacttcgaccaggcactgatgagggcccagaacaaacaacaagcccagacc
ggggccaaggcacagcaccaagcaacagcacacaatgggacgcattga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252634
Entry
112252634         CDS       T05605                                 

Definition
(RefSeq) retinoblastoma-like protein 2 isoform X1
  KO
K16332  retinoblastoma-like protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252634
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112252634
   04218 Cellular senescence
    112252634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112252634
Transcription factors [BR:otw03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    112252634
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 112252634
NCBI-ProteinID: XP_024279828
LinkDB
Position
6
AA seq 1108 aa
MNEEEDFLQKTRQGFEDLCRALNMDEEASNEAWKSYENISKNYTLEGSELHWLACALYVA
CRTAIPTVGKGTAEGNYVSLTRILSCSEQSLIEFFNKMKKWQDMASLPQEFCQSTEKLER
NFTISAVIFKKYIPIFKAIFKAPSDDPPRVHRSRKQRRHPCTVAEVFNFCWILFVNAKGN
FPMISDDLVNSYHLLLCALDLVFSNALLCNTRKELLNPNFKGLPEDFNSKDYKPTAGPYC
FIEQLCELHDGLVLEAKGVKEHFWKPFIKRLFHKKILKGKEDSLTGFFDPMNFGDSFASM
GRVYEEHVLATGGLDERIFLGEGANEDIGTPGPCLCVGVKNQDASAYRLYSSLTASALKV
STPLTGLKYVQDNCLGTPVSTAMQSVGRLHSLLTGLKHRPSGRLTDLLRACARDPSETIS
TRLKDMCQVYCQHFEGKGEENAGLGKDIAVKYFRLAEALYYKTLEAVIDQEKERLGDTDL
SGILEQDVFQRSLLACCLEIVIFSYRPPGDFPRVIHIFQLPAYHFYKVIEVLVRAEQGLF
REVVKHLNQVEEQVLESLAWRGGSPLWDSVREAKNQPPACQEVMPPQHLEDGNGDSSAGS
APLFPNNHGTDLSTNSGGKGVSPSPTTLLDRYSSPPTGSARRRLFVDASFDTPSDPSSTT
TTTTVRTSQAIVTTTIPAGQTVVTMATATVTANNGQTVTIPVQGIANENGGITFIPVQVS
VTGQGTAMLQPLSAQSLTGTLTSQPQTTTTLNSPAPQGSPATSKPIKKLAAQVLSTNKPQ
KKGSLSLFFRKVYHMASVRLRDLCAKLDISSELRRKIWTCFEYSLVQCTELMMDRHLDQL
LMCAVYVMTKVTKEDKSFQNIMKCYRSQPQASSSVYRSVLISGKKKRLLGSSVGNTQNSP
TDNSQKQGSGDSSPVPMCSTSTLPASQPGSIPSTPTLAPSTSSSLPPSQEQDKEGGVVGE
EERGDLIHFYNRVYIKQMRHFALRYSPSSPSAGVQSPPLCPYPSLRTSSPRRVLLSHNHS
IYISPHKTTGSPPTPSTTARDKIFYYICSSPSNRLAEINSMIRTGETPTKKRSMQLEEEP
SPKRVCPDNQTALLRRLQDVANDRSSSH
NT seq 3327 nt   +upstreamnt  +downstreamnt
atgaacgaggaggaagactttttgcagaaaacaaggcaggggtttgaagatctctgtcga
gctttgaatatggacgaggaggcgagcaacgaagcatggaagagctacgaaaacataagc
aaaaattacacattagagggcagtgagctacactggttagcctgtgctctctatgtggcc
tgcaggacagccataccaacggtgggtaagggcaccgcggagggaaactatgtctctctg
accaggatcctcagctgttcagaacaaagcctcattgagttctttaacaagatgaagaaa
tggcaggacatggcaagtctgccccaagaattttgccagagcacggagaagctggagagg
aatttcacaatttccgccgtcatcttcaagaaatatatccccatatttaaagccatcttt
aaggcaccctctgacgacccacccagagtccacaggagccgcaaacagaggcgccatccc
tgcaccgtcgctgaagtcttcaacttctgctggattctgtttgtcaacgctaaaggaaac
ttccctatgattagtgatgacctggtgaactcataccacctgctgctgtgtgctctggac
ctggttttctccaacgctctgctgtgtaacaccaggaaggagctgctcaaccccaacttc
aaaggccttcctgaggacttcaacagtaaggactacaagcctactgcggggccttactgc
ttcatagaacagctgtgtgaactgcatgatggcctggtgctggaggccaagggggtcaag
gaacacttctggaaaccgttcatcaagaggctcttccataagaagattctcaaagggaaa
gaagatagcttgactggcttcttcgatcctatgaattttggagacagttttgcgtccatg
gggcgtgtgtacgaggagcatgttctagccacagggggtctggatgagaggatcttcctg
ggagagggggccaatgaagacattggcacaccaggcccctgtctctgtgtgggagtaaag
aaccaggacgcctccgcatacagactctacagcagtctgactgcctcggccttgaaggtg
tctactcccctgacgggtcttaagtatgtccaggacaactgtctgggcacgccggtatct
acagccatgcagagtgttggccgactccacagcctgctcacaggactcaaacaccgcccc
agtggcagactcacagacttactgagggcgtgtgccagagacccaagtgagaccatctcc
actaggctgaaggacatgtgccaggtctattgtcagcactttgagggcaaaggggaggag
aacgcaggactggggaaagacatcgcagtgaagtacttccgcctggcggaggcgctctac
tataaaaccctggaggccgtcattgaccaggagaaagagagactgggcgacacggacctc
tctggtattctggagcaggatgtgttccagcgctctctgctggcctgctgtctagagatt
gtcatcttctcctaccgacccccaggggacttcccacgagtcatacacatcttccagctc
cccgcataccacttctacaaggtgattgaggtgctggtacgggcagagcagggcttgttc
agggaggtagtgaagcatctcaaccaggtggaggagcaggtcctggagagcctggcctgg
agggggggatccccgctgtgggacagcgtcagggaggccaagaaccagccaccagcttgc
caggaggtgatgccaccgcagcacctggaggatgggaatggagacagcagtgctggcagt
gcccctctcttccctaacaaccatggcactgacctaagcaccaacagtggtgggaaaggt
gtttctccctctcccaccaccctgttggaccgctacagctccccgcccacgggctcggcc
aggagacggctgtttgtggacgcttccttcgataccccatcggacccctcctccaccacc
accaccaccaccgtcaggacctcccaggccatcgtcaccaccaccatccctgctggacag
acagtggtcactatggcaacagccacggttaccgctaacaatggacagacggtcaccata
cccgtgcaaggaatagccaatgagaatgggggcatcaccttcatccctgtccaggtgagt
gtgacgggacaaggcacggccatgctccagcccctctctgcccagtccctgactggcact
ttgaccagccaaccacagaccaccactaccctgaacagtcctgccccacagggcagcccc
gccaccagtaaaccaatcaagaagctggcagcccaggtcctgtccactaacaagcctcag
aaaaagggttccctctcgctgttcttccgcaaggtgtaccacatggccagtgtgcgtctg
agagacttgtgtgccaagctggacatctctagtgagctgaggaggaagatctggacgtgt
tttgagtattccctggtgcaatgcacagagctcatgatggaccgacacctagaccagctc
ctcatgtgtgcagtttacgtcatgaccaaggtgaccaaagaggacaagtctttccagaac
atcatgaagtgctaccgctctcagccccaggccagcagcagcgtctaccggagtgtgttg
atctctgggaagaagaaacgtctcttgggcagcagtgtgggaaacacacagaactctccc
acagacaacagccagaagcaggggagtggagacagcagcccggtgcccatgtgttccacc
agcaccctacctgcctcgcagcctggcagcattccatccacccccaccctggccccctcc
acctcctcatccctccctccctcccaggagcaggataaggaggggggagtggtgggggag
gaggagcgaggagacctcatccacttctacaaccgggtctacatcaaacagatgcgtcac
tttgccctccgctactcgcccagctcgccctctgcaggggtacagtctcctcccctgtgc
ccgtacccctccctgaggaccagctcccctcgcagggtccttctgtcccacaaccactcg
atctacatctccccccacaagactactggaagcccccccaccccctccacaaccgcacgg
gacaagatcttctactacatctgcagcagcccatccaaccgcctggcggagatcaacagt
atgatccgcaccggggagacacccaccaagaagcgcagcatgcagcttgaggaagagcca
tcgcccaagagggtgtgtccagacaaccagacggccctgctccgcagattacaggacgtg
gccaacgaccgtagctcctcccactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264064
Entry
112264064         CDS       T05605                                 

Definition
(RefSeq) retinoblastoma-like protein 2
  KO
K16332  retinoblastoma-like protein 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112264064
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112264064
   04218 Cellular senescence
    112264064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112264064
Transcription factors [BR:otw03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    112264064
SSDB
Motif
Pfam: RB_B RB_A Baculo_gp64
Other DBs
NCBI-GeneID: 112264064
NCBI-ProteinID: XP_024296434
LinkDB
Position
12
AA seq 626 aa
MLHTFIQHYQEPWEENRSLDRDRGVKFSSQTEALYYRVLEAVINQERKRLGAKDLSGILE
HDLFQRSLVACCLEMVIFSHQPPGSFPLAIDIYSLAPFDFYKVIELVLRAEEGLLPGVVR
HLTHIEEQVLESLAWRRDSPLWDQIRAAKGQGQLPAYHQVMLPQYSEDTDKMAKVPPNPS
HLTPSLVNGIHGNDLNSPITHHEHYSSPPAGSKTAACPATPVSPSQSSSVIVTGQTVVTM
ASATVTTNNDQSVTIPVRGIANDRGAITFTLSVVGQPIPPQQVSSTSTQQPQNPLPSTQS
KGSISLFLRKVYHLVSMRLRDICVKLDICEALRLKIWTCVEHSLVHCTDLMLDRHLDQIL
MCAIYVMAKVTKVDMPFKLIMQCYKTQPQASNCVFRSVLISGRNTKTSQNSPGGSNRENI
DVDPSSSLLTYQSPPTHPTGRRAPCRQDQEERGHLIYFYNTVYVKQMKDFALRYTSSSLT
ITGVETPPLSPYPIQRIGSLRRLRPSNHHSLYISPHKPSTHPSPRTGFLYYVSRSPSKRL
REINDMMRTFQSRTRKRCAAQLQEDGEEEGGPLVKRPCQDRPSDWQRKLRDLGQDFNQAL
TRAQNQQQSQTRAKAQHQATAHKGTH
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgctccacaccttcatccagcactaccaggaaccatgggaagagaaccgcagcctagac
agagacagaggagtgaagttctccagccagacagaggctttgtactacagggttctagag
gctgtcatcaatcaggagaggaagaggctgggagccaaagacctttcaggcattctggag
catgatctgttccagcgctctctagtggcctgttgtctggagatggtaatcttctcccat
cagccaccaggcagcttccccctggccattgacatctatagcctggcgccattcgacttc
tacaaggtgatagagctggtgctgcgggctgaggagggcttgctgccgggtgtggtcagg
catctgacccatatagaggagcaggtcctggagagtctggcctggaggagagactcacca
ctctgggaccagatcagagctgctaagggtcagggacagctgcctgcataccatcaggtg
atgctcccccaatactcagaggacacagacaagatggccaaggtccctcccaacccttca
cacttgaccccaagccttgtgaatgggatccatggaaatgacctgaactccccgattacc
caccatgaacactacagctcaccccctgctggctcaaagacggctgcttgccctgccacc
ccagtcagcccatcccagtcctcctctgtcattgttactggacagactgtagtcaccatg
gcatcagccactgtcaccaccaacaatgaccagtcagtcaccataccggttcgaggcatt
gccaacgaccggggagccatcacatttaccctcagtgttgtaggtcagcccattcctcca
cagcaagtctccagcacctctacccagcagccccagaaccctctaccctctacccagagt
aagggctccatctcactgttcctccgcaaggtctaccacctggtgagcatgcgtctgagg
gacatctgtgttaaactggacatctgtgaggcgctgcggctgaagatctggacctgcgtt
gaacactccttggtccactgcactgacctcatgctagaccgacacctggaccaaatactc
atgtgtgccatctatgtcatggccaaggtaaccaaagtggacatgcccttcaagctcatc
atgcagtgctacaagactcagcctcaagcaagcaactgtgtattcagaagtgttctgatc
tcagggagaaacaccaagacctcacaaaactctcctggaggatccaacagagaaaacatt
gatgtagaccccagcagtagcttgcttacctaccagagccctcccacccatcctacagga
cgcagagctccctgtagacaggaccaggaggagagaggacacctcatctatttctacaac
accgtctatgtcaaacagatgaaggactttgccctgcgctacacctccagctctttgacc
ataaccggggttgaaacccctcccctttcgccataccccatccagcgtattggatccttg
cgcagactccgcccctccaaccaccattccctctacatctccccccacaagcctagcaca
cacccctccccccgcactgggttcctctactacgtgagcagaagcccctcaaagcgtctg
agagagatcaatgacatgatgaggacatttcaatcacgcaccaggaagcgctgtgcagcc
cagctgcaggaggacggtgaggaggagggtgggccacttgtgaagagaccctgtcaggat
agaccttcagactggcagagaaagctcagggacctcggccaggacttcaaccaggcactg
accagggcccagaaccagcaacaatcccagaccagggccaaggcacagcaccaagcaacg
gcacacaaggggacacattga

DBGET integrated database retrieval system