KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218861
Entry
112218861         CDS       T05605                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218861
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112218861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112218861
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112218861
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 112218861
NCBI-ProteinID: XP_024235846
LinkDB
Position
19
AA seq 274 aa
MKKPKIWIRVCVHLLLCITLGVQSSEFGNTVTDDITRISLLKQNIPKDYKIPVTYVPKEV
GGMCWVALNVFHLELSLRGLADKFGSISSNKYNISILIEMLKETRYHMKNLEAITYDFEC
HYRNEQWQTGHYFHFVEDFLKTARLNRDLPEECDPPPCPTATMDTTITTQYPTSVNYPAI
GTEFNMSAPDSETWNEPLRFLPEVVERSLLSLLVIPIAAVVFLFAWKVKSRRNQHQSDER
NSVEGGLFTGPEGTLAPPLEDPSEKNRLNIVETV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagccaaaaatttggatacgcgtctgtgtccatttattgctgtgcatcacactt
ggagtccagtcaagtgaatttggaaacactgtaacagatgacatcacaagaatttcacta
ttgaaacaaaatatacctaaagattacaagattcctgtgacatacgttccgaaagaagtg
ggtggaatgtgttgggtagcgctaaacgttttccacttggaactcagtttacgaggatta
gcagacaagtttggaagcatttcgtccaacaaatataatatcagcatattgatcgaaatg
ctgaaagagacaagatatcacatgaagaacttggaggcgatcacatatgattttgagtgc
cactacagaaatgagcaatggcagacaggacactattttcattttgtggaagatttttta
aaaacggcccgtttgaatagagatttgccagaagaatgtgatccacctccctgtcccaca
gcaacaatggatacaacaataacaacacaataccccacatcagtcaactatcctgccata
ggaacagaattcaacatgtcagcaccagactccgaaacctggaacgagcctctgagattc
ctgccagaagtagtggagagaagcctcctgtcactacttgtcattcctattgcagccgtt
gtatttctgtttgcgtggaaggtgaaatccaggaggaaccaacatcagtcagatgaacgg
aactcagtggaaggaggccttttcacaggaccagaagggactttggcacctccactagag
gacccttctgaaaagaacagattgaacatcgttgagacagtgtaa

DBGET integrated database retrieval system