KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219327Help
Entry
112219327         CDS       T05605                                 

Definition
(RefSeq) protein kinase C delta type-like
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04140  Autophagy - animal
otw04270  Vascular smooth muscle contraction
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112219327
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112219327
   04625 C-type lectin receptor signaling pathway
    112219327
  09152 Endocrine system
   04912 GnRH signaling pathway
    112219327
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112219327
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112219327
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112219327
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112219327
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112219327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 Kinase-like Zf_RING Pkinase_fungal zf-RING-like zf-RING_9 PADR1 PHD Haspin_kinase APH DZR DUF2318
Motif
Other DBs
NCBI-GeneID: 112219327
NCBI-ProteinID: XP_024236245
LinkDB All DBs
Position
2
AA seq 686 aa AA seqDB search
MSPFLRIAFNAFDVGVLPPLTDAPFCAIKMKESLSTERGKTLVQRKPTMYPAWKSTFDAH
IYEGRVLQVVLMKTAEEPLAEATVGVSVLAERCKKGNGCAEFWVDLQPSGKVQMVVQFFV
EDTDTAVFKSNVKGREEEDGAMTLTRRRGAMKQAKVHFIKNHEFTATFFGQPTFCSVCRE
FVWGFNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRETMFQKERFKIDMPHRFKIHN
YMSPTFCDHCGSMLWGMVKQGLKCEDCGMNSHHKCEKKVGNLCGINQKLLAEALNQVSQK
STRRSESNNSETTDIGIYQDFNKSPGADTSGGYEKLWEGGKGPAPASITPKTRLTIDSFV
FHKVLGKGSFGKVLLAELRGRGQYFAVKALKKDVVLMDDDVECTMVEKRVLALAWDNPFL
THLYSTFQTREHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYSAEIIIGLQFLHSKGII
YRDLKLDNVMLDRDGHIKIADFGMCKENVFGENRATTFCGTPDYIAPEILLGQKYTFSVD
WWSFGVLVYEMLIGQSPFQGDDEDELFESIRMDVPHYPRWITKEAKDLLEKLFERDPSRR
LGVVDNIRGHSFFKTLNWPALEKRELEPPFKPKVKGPNDCNNFDREFLSEKPRLSHTDKN
LIDSMDQTAFAGFSFINLKMEHIMDK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccttcttacgcatcgcctttaatgcgtttgatgtgggcgtcttgccacccctg
actgacgctcccttctgtgcaattaagatgaaggagtccctcagcactgagcgggggaag
accctagtccagaggaaacccactatgtaccctgcctggaagtccactttcgatgcccac
atctacgagggccgtgtcctccaagtggttctgatgaagaccgcagaggagccattggcc
gaggccacggtgggcgtgtccgtactggctgagcgctgtaagaagggcaacggctgtgct
gaattctgggtagacctgcagccttctgggaaggttcagatggtcgtccagttctttgtg
gaggacacagacacagcagtgtttaagtcgaacgtgaaggggcgtgaagaggaggatggg
gcgatgacactgacccgaaggagaggagccatgaaacaggccaaggtccatttcatcaag
aaccatgagttcacagccactttcttcggacagcccaccttctgctctgtctgccgggag
tttgtctggggattcaacaagcaaggctacaagtgcagacaatgcaacgccgccatccac
aagaaatgtattgacaaaatcatcgggaggtgcacaggaacagcagccaacagcagagag
actatgttccagaaggagcgttttaagatcgacatgccacatcgctttaagatccacaac
tacatgagccctaccttctgtgaccactgtggcagtatgctctggggaatggtcaagcag
ggcctcaagtgtgaagactgtggcatgaactcccatcacaaatgtgagaagaaagtggga
aatctctgtggaatcaaccagaaactcctggctgaggccctcaaccaagttagccaaaaa
tccacaagacggtctgaatctaacaactctgagacaacggacattggaatctaccaggac
ttcaacaaaagcccaggagcggacactagtggaggctatgagaagctgtgggagggaggt
aagggccctgccccagccagcatcacccccaagacccgcctcaccattgacagctttgtg
ttccacaaggtgctgggcaagggcagctttggcaaggtcctgctggctgagctgaggggg
cgaggacagtactttgctgtgaaggccctgaagaaagatgtggttctgatggatgatgat
gtggagtgtaccatggtggagaagagagtcctggccctggcctgggacaaccccttcctc
acacacctctactccaccttccagaccagggaacacctgtttttcgtgatggagtacctg
aatggaggagacctgatgttccacatacaggataagggtcgctttgacctctacagagcc
acgttctactcagcagagatcataattggactgcagtttctccactcaaaaggaatcatt
tacagggacctgaagctggacaatgtgatgctggacagagacggccacattaagatcgct
gactttgggatgtgcaaggagaacgtgtttggagagaatcgggccactactttctgtggg
acgccagactacatcgcaccagagattctgctgggacagaagtacaccttctccgtggac
tggtggtcgtttggggtactggtgtatgagatgctgattggccagtcgccgttccagggt
gatgacgaggatgagctgtttgagtccattaggatggacgtgcctcactaccctcgctgg
atcaccaaggaggctaaggacctattggagaagctgtttgaaagagaccccagtcgcagg
ctaggtgtggtggacaacatccgcggccactccttcttcaagaccctcaactggcctgcc
ctggagaagagagagctggaaccccccttcaaacctaaagtgaaaggccccaatgactgc
aacaactttgaccgggagttcctgagtgagaagccccgcctctcccacacggacaagaac
ctaatcgactctatggaccagacagcctttgcaggcttctctttcatcaacctcaagatg
gaacacattatggacaaatga

DBGET integrated database retrieval system