KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219493
Entry
112219493         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112219493
   04350 TGF-beta signaling pathway
    112219493
   04371 Apelin signaling pathway
    112219493
   04068 FoxO signaling pathway
    112219493
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112219493
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112219493
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 112219493
NCBI-ProteinID: XP_024236554
LinkDB
Position
20
AA seq 549 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQFAFDLKA
DNVCVNPYHYERVVSPGIDLSGLTLSSSGTLMVKDEYEFENQPSHSGADSHHQTIQHQPS
RPGGPQEFSSPALLPSPEGSSSASTSAFSSLAAGASTQSSSLLSGCHISEGLRQLSSGPG
PAQGQSSQQNGYPLAQSATYHHSATSGWLRNGNFSPSVPHHQNGHLQHHQPMPNTPHYWL
SHNEIAFQTPISNHPAPDYWCSIAYFEMDVQVGETFKVPASCPTVTVDGYVDPSGGDRFC
LGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPG
DAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAIS
LSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTM
PIADPQPLD
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtcgatcacaaacacccccacaagcaatgacgcttgtctgagcatcgtgcacagcctg
atgtgccacagacagggtggagagagcgagaccttcgccaagcgagccattgagagcctt
gttaagaaactgaaggagaagaaagatgagctagattctttaatcacagccatcaccacc
aacggagctcaccccagcaagtgtgtcaccatacagcgcaccctggatggacgcctgcag
gttgcggggcgtaaaggcttcccccatgtgatctatgcaagactgtggcggtggcctgac
ctgcacaaaaatgaactgaagcatgtgaaatactgccagtttgcttttgacctcaaagct
gacaatgtgtgtgttaacccataccactacgagagggtggtatcaccagggattgacctt
tcaggactgactctttcaagctcaggcacactcatggtcaaagatgagtatgaatttgag
aaccagccatctcactccggcgcggacagccaccatcagaccatccagcaccaaccctcc
agaccggggggtccccaggagttcagcagcccggccctgctcccttcccccgagggcagc
agctcagcctccacctctgccttctccagcctcgctgctggagcttcaacccagtccagt
agccttctgtcagggtgccatatcagtgaaggtctgcggcagctatcctcagggccaggc
ccagcacagggacagagctcacagcagaacggctatcccctggcacagagtgccacatac
catcacagtgccacctcaggctggctgagaaacgggaacttctccccctcagtgcctcac
caccagaatgggcacctgcagcaccaccaacccatgcccaacaccccacactactggctc
tcgcataatgagattgcattccagacccccatatccaatcaccctgcacctgactactgg
tgttccattgcctactttgaaatggatgttcaggttggggagacgttcaaggttccggcc
agctgccccacggtgactgtggacgggtacgtggatccctcgggaggggaccgcttctgc
ctgggtcagctcagcaatgtccacaggacagaggcaatcgagagagccagacttcacatt
ggtaaaggggtgcagttggagtgtaaaggggaaggggacgtgtgggtgcgttgccttagt
gatcatgcagtgtttgtgcagagttattacttggacagggaggcaggacgtgctcctgga
gatgcagtgcacaagatctaccccagcgcctacatcaaggtgtttgacctgcgccagtgc
cacaggcagatgcagcagcaggcagccacagcacaggcggcagccgcagcacaggcagcg
gcagtggctggaaacatccccgggcctggctctgtaggaggcatcgcccccgccatcagt
ttgtctgcggcggcaggtataggagtggacgacctgcgcaggctgtgtatcctgaggatg
agctttgtgaagggctgggggcctgactacccccggcagagcatcaaggagactccgtgc
tggattgagatccatctccaccgtgccctgcagctactggatgaggtgctgcataccatg
cccatcgctgacccccagcccctggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222845
Entry
112222845         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112222845
   04350 TGF-beta signaling pathway
    112222845
   04371 Apelin signaling pathway
    112222845
   04068 FoxO signaling pathway
    112222845
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112222845
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112222845
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 112222845
NCBI-ProteinID: XP_024241440
LinkDB
Position
23
AA seq 581 aa
MSVNPPNSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLKYD
NVCVNPYHYERVVSPGIVGLSIQNAGEEENTIFSIIKHHQNGPPGRLIKEEYIHDCFEMD
LPSRMPPQPERYNQPLPPLQMPPEPPRAPSSVNLYPSMPLSPPVSSSMMGPMSGGHGEGL
LQIASPQSQGMPQTPPPTTPTHGPPPQPPTPHSQSDYSSSSKHTQTQSSYHTTWTGTSTA
SYTPVGAQQNGRGHQQPPLHHPNHFWSQQHHSAPAFPQPVSNHPGPEFWCSISYFEMDIQ
VGEMFKVLANCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGE
GDVWMRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYMKVFDLRQCHRQMQQQAATA
QAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYP
RQSIKHTPCWVEVHLHRALQLLDEVLHTMPLADLGGHGHVN
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcagtgaacccccccaacagcaacgatgcctgcctgagcatcgtgcacagcctcatg
tgccaccgacagggcggtgagaacgagggctttgccaagcgtgccatagagagcctggta
aagaagctgaaggagaagaaggatgagctggactcgctcatcaccgccatcaccaccaac
ggagttcaccccagcaagtgtgtcaccatccagaggacgcttgatggacgcctgcaggta
gctgggaggaaagggttcccccatgtgatctacgctaggctctggcgctggccagacctc
cacaagaatgaactgaagcacgtcaagttctgccagttcgcctttgacctcaagtatgac
aatgtgtgtgtcaacccctaccactacgagcgagtggtatcgccaggcattgttggtctc
agcattcaaaatgcaggtgaggaggaaaacactattttcagcatcatcaaacatcatcaa
aatggtcctccaggtcggctgatcaaagaggagtacatccatgactgttttgagatggac
ctcccctccaggatgcccccccagcccgagcgctacaaccagccccttccccctctgcag
atgccccccgagccgccccgcgccccatcctccgtcaacctctaccccagcatgcccctc
tctccgccagtgagcagttccatgatggggcccatgtctgggggccatggcgagggcctg
ctccagatcgcctctccccagagccagggcatgccccagacaccgccacccaccaccccc
acacacggaccacccccccagccccctacccctcacagccagagtgactacagcagcagc
tccaaacacacacagacacagagctcttatcacacgacctggacaggcaccagcacggcc
tcttatacccctgtaggagcccagcagaatgggcgtggccaccagcaaccaccactgcac
caccccaaccacttctggtctcagcaacatcacagcgcacccgcctttcctcagccagtc
tccaaccatccaggtccagagttctggtgctccatctcctactttgagatggacatccag
gttggggagatgttcaaggtcctggctaactgccccgtggtgacagtggacggatacgtg
gacccctcagggggcgaccgcttctgtctgggccagctcagcaacgtgcaccgcaccgac
gctagcgagagagccaggttgcacattgggaagggggtgcagttagagtgtcgtggtgag
ggggatgtgtggatgcgttgccttagcgaccatgcagtgttcgtacagagctactacctg
gaccgggaggcggggcgagccccgggagacgcagttcacaagatctaccctggggcctac
atgaaggtgtttgacctgcgtcagtgccacaggcagatgcagcagcaggcagccacagcc
caggctgcagcagcagcacaggctgcagcagtggcaggcaacatcccagggcctggcagt
gtggggggaatcgccccggcagtcagtctgtcggcggcagccgggataggtgtggacgac
ctgcggcggctgtgtatcctgcggctcagctttgtgaagggctgggggcccgactacccc
cggcagagcatcaagcacaccccctgctgggtggaggtccacctgcaccgcgccctgcag
ctgctggatgaggtgctgcacaccatgcctctggctgacctaggaggacacggacatgtc
aactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228561
Entry
112228561         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112228561
   04350 TGF-beta signaling pathway
    112228561
   04371 Apelin signaling pathway
    112228561
   04068 FoxO signaling pathway
    112228561
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112228561
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112228561
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 112228561
NCBI-ProteinID: XP_024249744
LinkDB
Position
3
AA seq 581 aa
MSVNPPNSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLKYD
NVCVNPYHYERVVSPGIVGLSIQNAGEEENTIFSIIKHHQNGPPGRLIKEEYIHDCYEMD
LPSRMPPQPEHYNQPLPPLQMPPEPPRAPSSVNLYPSMPLSPPVSSSMMGPMSGGHGEGL
LQIASPQIQGIPQTPPPTTPPHGPPPQPPTPHSQSDYSSSSKHTQTQSSYHTTWTGTSTA
SYTPVGPQQNGRGHQQPPLHHPNHFWSQQHHSAPAFPQPVSNHPGPEFWCSISYFEMDIQ
VGEMFKVLANCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGE
GDVWMRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYMKVFDLRQCHRQMQQQAATA
QAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYP
RQSIKHTPCWVEVHLHRALQLLDEVLHTMPLADLGGHGHVN
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcagtgaacccccccaacagcaacgatgcctgcctgagcatcgtgcacagcctcatg
tgccaccgacagggcggtgagaacgaggggtttgccaagcgtgccatagagagcctggta
aagaagctgaaggagaagaaggatgagctggactcgctcatcaccgccatcaccaccaac
ggagttcaccccagcaagtgtgtcaccatccaaaggacgcttgatggacgcctgcaggta
gctgggaggaaagggttcccccatgtgatctacgctaggctctggcgctggccagacctc
cacaagaatgaactgaagcatgtcaagttctgccagttcgcctttgacctcaagtatgac
aacgtgtgtgtcaacccctaccactacgagagagtggtatcgccaggcattgttggtctc
agcattcaaaatgcaggtgaggaggaaaacactattttcagcatcatcaaacatcatcaa
aatggtcctccaggtcggctgatcaaagaggagtacatccatgactgttatgagatggac
ctcccctccaggatgcccccccagcccgagcactacaaccagcccctcccccctctgcag
atgccaccagagccgccccgcgccccatcctccgtcaacctctaccccagcatgcccctc
tctccgccagtgagcagctccatgatggggcccatgtctgggggccacggcgagggcctg
ctccagatcgcgtctccccaaatccagggcattccccagacgccacccccaaccaccccc
ccccacggaccacccccccagccccctacccctcacagccagagtgactacagcagcagc
tccaaacacacacagacacagagctcctatcacacaacctggacaggcaccagcacggcc
tcctatacccctgtaggaccccagcagaatgggcgtggccaccagcaaccaccactgcac
caccccaaccacttctggtctcagcaacatcacagcgcacccgcctttcctcagccagtc
tccaaccatccaggtccagagttctggtgctccatctcctactttgagatggacattcag
gttggggagatgttcaaggtcctggctaactgccccgtggtgacagtggacggatacgtg
gacccctcggggggcgaccgcttctgtctgggccagctcagcaacgtgcaccgcaccgac
gccagcgaaagagccaggttgcacattgggaagggggtgcagttggagtgtcgtggtgag
ggggatgtgtggatgcgttgccttagtgaccatgcagtgttcgtacagagctactacctg
gaccgggaggcggggcgagccccgggagacgcagttcacaagatctaccctggggcctac
atgaaggtgtttgacctgcgtcagtgccacaggcagatgcagcagcaggcagccacggcc
caggctgcagcagcagcacaggctgcagcggtggcaggcaacatcccagggcctggcagt
gtggggggaatcgccccggcagtcagtctgtcggcggcagccgggataggtgtggacgac
ctgcggcggctgtgtatcctgaggctcagctttgtgaagggctgggggcccgactaccct
cggcagagcatcaagcacaccccctgctgggtggaggtccacctgcaccgtgccctgcag
ctgctggatgaggtgctgcacactatgcctctggctgacctaggaggacatggacatgtc
aactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229740
Entry
112229740         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112229740
   04350 TGF-beta signaling pathway
    112229740
   04371 Apelin signaling pathway
    112229740
   04068 FoxO signaling pathway
    112229740
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112229740
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112229740
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 112229740
NCBI-ProteinID: XP_024251515
LinkDB
Position
31
AA seq 594 aa
MSVNAPSSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGLSLQNTALSLSPLGPPGRLIKEEYIHDCIQMDMPLGMSPSD
HPHPGALKLPPPDHYGQPLPPLQLPPEPQCAPPPITLYPNMPLSPTVPGSMLPLQGGHSE
GLLQIASPQGQVMTPITPTPPPSTPTHGLPHGPQHTPQPPTPSGQNGYNSSKHTQTQAAF
HTTWTGSSTASYTPVGPQQQNGRGHQQPPLHHPTHFCKLGSYRSQHHGSASFPPPVSNHP
GPEFWCSISYFEMDVQVGEMFKVPASCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDSSER
ARLHIGKGVQLECRGEGDVWMRCMSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKVF
DLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRL
CILRLSFVKGWGPDYPRQSIKHTPCWVEVHLHRALQLLDEVLHTMPLADPGPAN
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgtcggtgaatgcccccagcagcaatgacgcctgcctgagcatcgtgcacagcctcatg
tgccaccggcagggcggcgagaatgagggcttcgccaagcgcgccatcgagagcctggtg
aagaagctgaaggagaagaaggacgagctggactcgctcatcaccgccatcaccaccaat
ggagtgcaccccagcaagtgtgtgaccatccagaggaccctagacggtcgcctgcaagtt
gcagggaggaaaggcttcccccatgtgatttacgctcgactatggcgctggccagacctg
cacaagaatgagctaaagcacgtcaaattctgccaatacgcttttgacctcaaatatgac
aatgtgtgtgtcaacccctaccactatgagagagtggtttctcccggcattgttggtctc
agtcttcaaaatacagccctctccctctctcctctaggcccccctgggaggttgatcaaa
gaggagtacattcatgactgtatccagatggatatgccactaggcatgtccccatcggac
cacccccacccaggggccctcaagctaccgcctcccgaccactacggccagcccctcccg
cctctgcagctcccgccggaaccgcagtgcgcccctccgcccatcaccctctaccccaac
atgcccctctcgcccacagtgcccggctctatgctgcctctccagggaggtcacagtgag
gggctcctacagatcgcctctccgcagggtcaggtcatgacccctataacccccacgccg
cccccctccaccccaacacacgggctaccacatgggccacaacacaccccccagccaccc
actccgtctggtcagaatggatacaacagctccaaacacacacagacacaggctgcgttc
cacacaacttggacaggcagcagcacagcatcctacactcctgtaggaccccaacaacag
aatgggcgtggccaccaacagcctcctctccaccatccaacccacttctgtaagttaggc
agttacaggtctcagcatcatggctcggcttcatttcctccccctgtgtccaatcatcca
ggaccagagttctggtgctccatctcctactttgagatggatgtccaggtgggggagatg
ttcaaggtgccggccagctgcccggtggtgacggtggacggctacgtggacccctcaggg
ggcgaccgcttctgtctgggccagctcagcaacgtccaccgcaccgactccagcgaaaga
gccaggttgcacataggtaaaggagtgcagctggagtgtcgtggcgagggagatgtgtgg
atgcgctgtatgagcgaccacgccgtgttcgtgcagagctactacctggaccgagaggca
ggcagagcaccaggcgacgcagtacacaagatctaccccggcgcctacatcaaggtgttt
gacctgagacagtgtcacaggcagatgcagcagcaagcagctacagcgcaggcagcagca
gcagctcaggctgccgccgtggccggcaacatccccgggccaggcagtgttggaggcatt
gcccctgcagtcagtctttctgctgcagcggggataggtgtagatgatctccggaggctg
tgtattttgcggctgagctttgtgaagggttgggggcccgactacccccggcagagcatc
aaacataccccctgttgggtggaggtacacctgcaccgggctctgcagctgctggacgag
gtactacacaccatgcccttggccgacccaggacccgctaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232409
Entry
112232409         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112232409
   04350 TGF-beta signaling pathway
    112232409
   04371 Apelin signaling pathway
    112232409
   04068 FoxO signaling pathway
    112232409
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112232409
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112232409
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 112232409
NCBI-ProteinID: XP_024255191
LinkDB
Position
Unknown
AA seq 580 aa
MSVNAPSSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGLSLQNTALSPLGPPGRLIKEEYIHDCIQMDMPPGISPHPGA
LKLQPPDHYGQPLPPLQLPPEPQRAPLPITLYPNMPLSPTVSGSMLPLQGGHSEGLLQIA
SPQGQVMTPMTPTPPPSTPTHGLPHGPPQNPQPPPGQNGYNSSKHTQSQAAFHTTWTGSS
TASYTPVGPQQQNGRGHQQPPLHHPTSFWSQHHGSASFPPPVSNHPGPEFWCSISYFEMD
VQVGEMFKVPASCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECR
GEGDVWMRCMSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAA
TAQAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPD
YPRQSIKHTPCWVEVHLHRALQLLDEVLHTMPCLRPGPAN
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtcggtaaacgcccccagtagcaatgacgcctgcctgagcatcgtgcacagcctcatg
tgccaccggcagggtggcgagaatgagggtttcgccaagcgtgccatcgagagcctggtg
aagaagctcaaggagaagaaggacgagctggactcgctcatcaccgccatcaccaccaac
ggtgtgcaccccagcaagtgtgtcaccatccagaggaccctggacggacgcctgcaggtt
gcagggaggaaaggcttcccccatgtgatctacgctcgattatggcgctggccagaccta
cacaagaatgagctaaagcacgtcaagttctgccaatacgccttcgacctcaaatatgac
aatgtgtgtgtcaacccttaccactatgagagagtggtttcgcccggcattgttggtctc
agtctccaaaatacagccctctctcctctaggcccccctgggaggctgatcaaggaggag
tatattcatgactgtatccagatggatatgccaccaggcatatccccccacccaggggcg
ctcaagctacagcctccggaccactacggccagccactcccgcctctgcagctcccgccg
gaaccgcagcgggcccctctgcccatcaccctctaccccaacatgcccctctcgcccaca
gtgtccggctctatgctgcctctccagggaggtcacagtgaggggctcctacagatagcc
tctcctcagggtcaggtcatgacccctatgacccccacgccgcccccctccaccccaaca
cacgggctgccacacgggccaccgcagaacccccagcccccgcctggtcagaatggatac
aacagctccaaacacacacagtcacaggctgcgttccacacaacttggacaggtagtagc
acagcctcctacactcctgtgggaccccaacaacagaatgggcgtggccaccaacagcct
cctctccaccatccaaccagcttctggtctcagcatcatggctctgcctcatttcctccc
cctgtgtccaatcatccagggccagagttctggtgctctatctcctactttgaaatggat
gtgcaggtgggggagatgttcaaggtgccggctagctgcccggtggtgacggtggacggc
tacgtggacccctcagggggcgaccgcttctgtctgggccagctaagcaacgtccaccgc
accgacgccagcgaaagagccaggttgcacataggtaaaggagtgcagctggagtgtcgt
ggcgagggagatgtgtggatgcgctgtatgagcgaccacgccgtgttcgtgcagagctac
tacttggatcgagaggcaggtagagcgccaggcgacgcagtacacaagatctaccccggc
gcctacatcaaggtgtttgacctgagacagtgtcacaggcaaatgcagcagcaggcagct
acagcgcaggcagcggcagcagctcaggctgccgccgtggcaggcaacatccctgggcca
ggcagcgttggaggcatagcccctgcagtcagtctttctgcagcagcagggataggtgtg
gacgacctccggaggctgtgtatcctgcggctgagctttgtgaagggctggggccctgac
tacccccggcagagcatcaaacataccccctgttgggtggaggtacacctgcaccgggct
ctgcagctgctggacgaggtactacacaccatgccttgtctgcgcccaggacccgctaac
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248311
Entry
112248311         CDS       T05605                                 

Gene name
smad4
Definition
(RefSeq) LOW QUALITY PROTEIN: mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112248311 (smad4)
   04350 TGF-beta signaling pathway
    112248311 (smad4)
   04371 Apelin signaling pathway
    112248311 (smad4)
   04068 FoxO signaling pathway
    112248311 (smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112248311 (smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112248311 (smad4)
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 112248311
NCBI-ProteinID: XP_024272993
LinkDB
Position
4
AA seq 509 aa
MSITNTPSSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIGRTLDGRLQVAGRKGFPHVIYTRLWRWPDLHKNELKHVKYCQFAFDLKC
DSVCVNPYHYDRVVSPGIDLSSLQLTSSAPSLGLMVKDEYDFDGQAPLPTMDGGHSLQTI
QHPPSSRGGPPSEPFGTPGLLSPSDASTASTSAFPSISVGSGNATSTWTRNSSFTPXMPH
HQNGHLQXHPPMPPPGHYWPVHKELGFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPS
TGPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGIQLEGKGEGDVWVRCLS
DHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAA
AVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRTSIKETPC
WIEIHLHRALQLLDEVLHTMPIGDPQPLD
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtctatcaccaacacgccttcgagtaatgatgcttgcctgagcattgtacacagcttg
atgtgtcacaggcaagggggagagagcgagacctttgccaagcgggcaatagaaagcctg
gtgaaaaagctgaaggagaagaaggatgaactggactccctaatcacagccatcaccacc
aatggagctcatcccagcaagtgtgtcaccattgggcggactctggatggccgtttgcag
gtggcagggcggaaagggtttccccacgtgatctacactcggttgtggagatggcctgat
ctgcataaaaatgaactgaaacatgtgaaatattgccagtttgcgtttgacctgaagtgt
gacagcgtttgcgtgaacccataccactacgaccgggtggtgtctccaggtattgatcta
tcaagtttgcaacttaccagctcagctccaagcctgggactgatggttaaagatgaatac
gactttgatggccaggccccactgcccaccatggacgggggtcactccctccagaccatt
cagcaccccccctctagccgaggtgggccaccctcagagcccttcggcacccctggcctg
ctgtccccctctgatgccagcaccgcctccacctccgccttccccagcatctctgtcgga
tcaggaaatgccacctccacctggactagaaatagcagcttcacgccanacatgcctcac
catcagaatgggcacctgcaancacacccacccatgcctcctccaggacattactggcct
gtgcacaaagagcttggcttccagccacccatatccaaccatccagcgcccgactactgg
tgttccatcgcctactttgagatggacgtgcaggtgggcgagaccttcaaggtgccctcc
actggccccgtcgtgacggtggatggctatgtggacccgtctgggggagaccgcttctgt
ctaggccagctgagcaacgtgcaccggaccgaggccatcgaaagagccaggctccacatc
ggtaaggggatccagttggagggtaaaggtgaaggggacgtgtgggtacgctgcctcagc
gaccacgctgtgttcgtgcagagctattacctggaccgggaagccggccgcgcccctggt
gacgccgtgcacaagatctaccccagcgcctacatcaaggtgtttgacctgcgtcagtgc
cacaggcagatgcagcagcaggcagcgacggcgcaggcggcagccgcggctcaggcagcc
gccgtggctgggaacatccctgggccgggctctgtgggaggcatcgctcctgccatcagc
ctttcagctgctgccggcatcggagtggacgacctgaggagactgtgcatcctgcgcatg
agcttcgtcaagggctggggtcccgactacccccggacgagcatcaaggagaccccgtgc
tggattgagatccacctacaccgggccctccagctactggacgaggtgctgcacaccatg
ccaatcggtgacccccagcccctggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257537
Entry
112257537         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112257537
   04350 TGF-beta signaling pathway
    112257537
   04371 Apelin signaling pathway
    112257537
   04068 FoxO signaling pathway
    112257537
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112257537
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112257537
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF1955
Other DBs
NCBI-GeneID: 112257537
NCBI-ProteinID: XP_024286949
LinkDB
Position
9
AA seq 562 aa
MIEHQVIDCRTVSKMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKE
KKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYATLWRWPDLHKNEL
KHVKYCQFAFDLKADNVCVNPYHYERVVSPGIDLSGLTLSSSGTLMVKDEYEFENQPSHS
GADGHHQTIQHQPSRPGGPQELFSSSALLPPPEGSSSASTSAFSSLAAGASTQSTSLLSG
SHSTEGLRQLSSRPGPGPSQGQSGFSLAQSATYHHNAASGWPRNGNFTPSVPHHQNGHLQ
HHQPMTHTPHYWMVNNEIAFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPASCPTVTV
DGYVDPSGGDRFCLGQLCNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQ
SYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATSQAAAAAQAAAVTGNIP
GPGSVGGIAPAISMSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLH
RALQLLDEVLHTMPIADPQPLD
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgattgaacatcaagtaatagactgtagaacggtaagcaagatgtcgatcacaaacacc
cccacaagcaacgatgcttgcttgagtatcgtgcacagcctgatgtgccacagacagggt
ggagagagcgagacattcgccaagcgagccatcgagagcctcgtcaagaaactgaaggag
aagaaagatgagctagattctctcatcacagccatcaccaccaacggagctcaccccagc
aagtgtgtcaccatacagcgcaccttggatggacggttgcaggtcgcagggcgtaaaggc
ttcccccatgtgatctatgccacattgtggcggtggcctgacctgcacaagaatgaactg
aagcatgtgaaatactgccagtttgcctttgacctcaaagctgacaatgtgtgtgttaac
ccataccactacgagagggtggtatcaccagggattgacctttcaggactgactctttca
agctcgggcacactcatggtcaaagatgagtatgaatttgagaaccagccatctcactct
ggtgcggatggccaccaccagaccatccagcaccagccctccagaccagggggtccccag
gagttgttcagcagctcggctctgctccctccccctgagggcagcagctcagcctctacc
tctgctttctccagcctcgctgctggagcctcaacccagtccactagccttctgtcaggg
agccatagcactgaagggctgcggcagttatcctcaaggccaggcccagggccttcacag
gggcagagcggcttctccctggcacagagtgccacataccatcacaatgccgcctcaggc
tggccgagaaatgggaacttcaccccctcagtgcctcaccaccagaatgggcacctgcag
caccaccaacccatgacccacaccccacactactggatggtcaacaatgagattgcattc
cagccccccatctcaaatcatccggcccctgactactggtgctccattgcctactttgag
atggatgttcaggtgggggagacgttcaaggttccggccagctgccccacggtgacagtg
gatgggtacgtggatccctcaggaggggaccgcttctgcctgggccagctctgcaatgtc
cacaggacagaggccatcgagagagctagacttcacattggtaaaggggtgcagctggag
tgtaaaggggaaggtgacgtgtgggtgcgttgccttagcgatcatgcagtgtttgtgcag
agttattacttggacagggaggcaggacgggcccctggagatgcagtgcacaagatctac
cccagcgcctatatcaaggtgtttgacctgcgtcagtgccacaggcagatgcagcagcag
gcagccacatcccaggcggcagccgcagcacaggcagcagcagtgactggaaacatcccc
gggcctggctctgtgggaggcatcgcacccgccattagtatgtctgcggctgcgggtata
ggagtggatgacctgcgcaggctgtgtatcctgagaatgagctttgtgaagggctggggg
cctgactacccccggcagagcatcaaggagacaccgtgctggattgagatccatctccac
cgggccctgcagctattggatgaggtgctgcacaccatgcccattgctgaccctcagccc
ttggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263427
Entry
112263427         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112263427
   04350 TGF-beta signaling pathway
    112263427
   04371 Apelin signaling pathway
    112263427
   04068 FoxO signaling pathway
    112263427
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112263427
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112263427
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 112263427
NCBI-ProteinID: XP_024295388
LinkDB
Position
12
AA seq 507 aa
MSITNMPTSNDACLSIVHSLMCHRQGAESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYTRLWRWPDLHKNELKHVKYCQFAFDLKC
DNVCVNPYHYDRVVSPGIDLSSLTLTSTATSLGLMVKDEYDFDGQPQLPPMDGGHSIQTI
QHPPSSRVGPPSEPFSTAGLLPLADARTTSAFPSISVGSGNATSTWTRNSSFMPNMPQHQ
NGHLQHHPPMPHPGHYWPVHNEHGFQPPISNHPAPDYWCSTAYFEMDVQVGETFKVPSTC
PVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGIQLECKGEGDVWVRCHSDH
AVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLHQCHRQMQQQAATAQAAAAAQAASI
AGNISGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRTSIKETPCWI
EIHLHRALQLLDEVLHTMPIADPQPLD
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtctatcaccaacatgcctacgagtaacgacgcttgcctgagcattgtacacagcttg
atgtgtcataggcaaggggcagagagtgagacctttgccaagcgagcaatagaaagtcta
gtgaaaaagctgaaggagaagaaggatgaactggactcccttatcacagccatcaccacc
aatggagctcaccccagcaagtgtgtcaccatccagcggactctggatggccgcctgcag
gtagcagggcgtaaagggttcccccacgtgatctacactcggttgtggagatggcccgat
ctgcataaaaatgaactgaagcatgtcaaatactgccagtttgcgtttgacctgaagtgt
gacaacgtctgcgtgaacccctaccactatgaccgggtggtgtctccgggtattgaccta
tcaagcttgactcttaccagcacagctaccagcctgggactgatggttaaagatgagtac
gactttgacggccagccccagctgccccccatggacgggggtcactccatccaaaccatc
cagcatcctccctccagccgagttgggcccccctcggagcccttcagcaccgctggcctg
ctgcccctcgctgatgcccgcaccacctccgccttccccagcatatctgttggatctgga
aatgccacctccacctggacgagaaacagcagcttcatgcccaacatgcctcaacatcag
aatgggcacctgcaacaccacccacccatgcctcatccagggcactactggcctgtgcac
aacgagcatggcttccagccccccatatccaaccatccagcgcccgattactggtgctcc
actgcttactttgagatggacgtgcaggtgggcgagaccttcaaggtgccctccacttgc
cctgtcgtgaccgtggacggctacgtggacccttcgggtggagaccgcttctgtctgggc
cagctgagcaacgtgcaccggacagaggccattgaaagagccaggctccacatcgggaag
gggatccagctggagtgcaaaggtgaaggggacgtgtgggttcgttgccatagcgaccac
gcagtgtttgtgcagagctactacctggacagggaagccggccgtgcccccggcgacgcc
gtgcacaagatctaccccagcgcctacatcaaggtgtttgacctgcatcagtgccacagg
caaatgcagcagcaggcagcgacggcgcaggcggcagccgcagctcaggctgcctctatt
gctgggaacatctctgggccgggctccgtgggaggcatcgctcccgccatcagcctttcg
gcagcagccggcatcggtgtggacgacctgaggagactgtgcatcctgcgcatgagcttt
gtcaagggctggggtcccgattacccccggacgagtatcaaggagaccccctgctggatt
gagatccacctacaccgcgccctccagctactggacgaggtgctgcacaccatgcccatc
gctgacccccaacccttggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264720
Entry
112264720         CDS       T05605                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04310  Wnt signaling pathway
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112264720
   04350 TGF-beta signaling pathway
    112264720
   04371 Apelin signaling pathway
    112264720
   04068 FoxO signaling pathway
    112264720
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112264720
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112264720
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 112264720
NCBI-ProteinID: XP_024297267
LinkDB
Position
13
AA seq 580 aa
MSVNAPSSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGLSLQNTALSPLGPPGRLIKEEYIHDCIQMDMPPGISPHPGA
LKLQPPDHYGQPLPPLQLPPEPQRAPLPITLYPNMPLSPTVSGSMLPLQGGHSEGLLQIA
SPQGQVMTPMTPTPPPSTPTHGLPHGPPQNPQPPPGQNGYNSSKHTQSQAAFHTTWTGSS
TASYTPVGPQQQNGRGHQQPPLHHPTSFWSQHHGSASFPPPVSNHPGPEFWCSISYFEMD
VQVGEMFKVPASCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECR
GEGDVWMRCMSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAA
TAQAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPD
YPRQSIKHTPCWVEVHLHRALQLLDEVLHTMPCLRPGPAN
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtcggtaaacgcccccagtagcaatgacgcctgcctgagcatcgtgcacagcctcatg
tgccaccggcagggtggcgagaatgagggtttcgccaagcgtgccatcgagagcctggtg
aagaagctcaaggagaagaaggacgagctggactcgctcatcaccgccatcaccaccaac
ggtgtgcaccccagcaagtgtgtcaccatccagaggaccctggacggacgcctgcaggtt
gcagggaggaaaggcttcccccatgtgatctacgctcgattatggcgctggccagaccta
cacaagaatgagctaaagcacgtcaagttctgccaatacgccttcgacctcaaatatgac
aatgtgtgtgtcaacccttaccactatgagagagtggtttcgcccggcattgttggtctc
agtctccaaaatacagccctctctcctctaggcccccctgggaggctgatcaaggaggag
tatattcatgactgtatccagatggatatgccaccaggcatatccccccacccaggggcg
ctcaagctacagcctccggaccactacggccagccactcccgcctctgcagctcccgccg
gaaccgcagcgggcccctctgcccatcaccctctaccccaacatgcccctctcgcccaca
gtgtccggctctatgctgcctctccagggaggtcacagtgaggggctcctacagatagcc
tctcctcagggtcaggtcatgacccctatgacccccacgccgcccccctccaccccaaca
cacgggctgccacacgggccaccgcagaacccccagcccccgcctggtcagaatggatac
aacagctccaaacacacacagtcacaggctgcgttccacacaacttggacaggtagtagc
acagcctcctacactcctgtgggaccccaacaacagaatgggcgtggccaccaacagcct
cctctccaccatccaaccagcttctggtctcagcatcatggctctgcctcatttcctccc
cctgtgtccaatcatccagggccagagttctggtgctctatctcctactttgaaatggat
gtgcaggtgggggagatgttcaaggtgccggctagctgcccggtggtgacggtggacggc
tacgtggacccctcagggggcgaccgcttctgtctgggccagctaagcaacgtccaccgc
accgacgccagcgaaagagccaggttgcacataggtaaaggagtgcagctggagtgtcgt
ggcgagggagatgtgtggatgcgctgtatgagcgaccacgccgtgttcgtgcagagctac
tacttggatcgagaggcaggtagagcgccaggcgacgcagtacacaagatctaccccggc
gcctacatcaaggtgtttgacctgagacagtgtcacaggcaaatgcagcagcaggcagct
acagcgcaggcagcggcagcagctcaggctgccgccgtggcaggcaacatccctgggcca
ggcagcgttggaggcatagcccctgcagtcagtctttctgcagcagcagggataggtgtg
gacgacctccggaggctgtgtatcctgcggctgagctttgtgaagggctggggccctgac
tacccccggcagagcatcaaacataccccctgttgggtggaggtacacctgcaccgggct
ctgcagctgctggacgaggtactacacaccatgccttgtctgcgcccaggacccgctaac
tga

DBGET integrated database retrieval system