KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219510
Entry
112219510         CDS       T05605                                 

Definition
(RefSeq) interleukin-7 receptor subunit alpha-like isoform X1
  KO
K05072  interleukin 7 receptor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112219510
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112219510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:otw04050]
    112219510
   04090 CD molecules [BR:otw04090]
    112219510
Cytokine receptors [BR:otw04050]
 Interleukin receptor families
  IL2 receptor family
   112219510
CD molecules [BR:otw04090]
 Proteins
  112219510
SSDB
Other DBs
NCBI-GeneID: 112219510
NCBI-ProteinID: XP_024236587
LinkDB
Position
20
AA seq 422 aa
MAYSLWIALLLLPVLVHSQSGREWADNEPRILCTSHLSLSSPNTLTCYLDDDNGDDEIED
VKAMTLCYSKRIGEQRCLTEKGNNVTFTNLDTLSPCNLTIQLKGGSTFWKTILLAKIIKP
MSPWVVNVTFLGSSNRALIYIGNPYLNDYLKARNQLFQFHIWSVKNTLFHSITYQPLIIE
GDEYLHKNTEYHVKVRAKPNGGYFEGSWSEWSVPLSFRTDEETKTDVQMLSYSLIVAIFA
LLLVTLAVSIFWRIQIHSFIWPSIPHPKHTLLQIVQTYEPMKQGQPLSFNPEVFSDLKIQ
LVELDEEQHVTAQTPDSNANHLTEVKDQYLIQECDGDTKSCHSTSSGGSEAILLRCESPG
EHPNFGAGSSGSTMGILDLKSDTESVETDDSDGNIGPEGLVATQQGDKGEVYVTMSSFYQ
IQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcatacagcctgtggattgccctactccttctcccggttctggtgcactctcaaagt
ggaagagaatgggctgacaatgaacccagaatactctgcacttctcatctaagtctgtcg
tcaccaaacaccctaacctgctaccttgatgatgacaacggggatgatgaaatagaggac
gtaaaagccatgactctttgctacagcaagcgcattggtgagcaacgctgtctaacagag
aaggggaataatgtcacatttacgaacctggacacactgtcaccatgtaatctcaccatt
caattgaaaggaggcagcacattttggaaaacaatcctcttggcaaaaataattaaaccc
atgagtccttgggtggtgaatgtcacatttctggggagctccaaccgggctcttatctac
attgggaatccatacctaaacgattacctgaaagcccgcaatcaactgttccaatttcac
atctggagtgtcaaaaatactctgtttcatagcataacctatcagcctctgatcatcgag
ggggacgagtacctccataagaacacagagtatcacgtcaaggttcgagccaagccaaac
ggggggtactttgaagggagctggagtgaatggagtgtccctctcagtttcagaacagac
gaagagacaaagacagatgtccagatgctgtcctactcactcatcgtggccatttttgct
ctgcttctggtcaccttggcagttagtattttctggagaatacaaatacattccttcata
tggccaagcattccacatcccaaacacacacttctccagatcgtccagacgtacgagcca
atgaagcagggccaacctctgagctttaaccccgaggtgttcagtgacctcaagatccag
ctggtggagctggacgaggagcagcacgttactgcccaaacccctgactctaacgccaat
cacctcactgaggtcaaagatcaatacctcattcaggagtgtgacggagatacgaagtcc
tgccatagcaccagtagtggaggttcggaggccatactgttgaggtgtgagtccccagga
gagcaccccaactttggggctgggagcagtggctccaccatgggtatcctggacctgaag
agtgacacggagagtgtggagacagacgacagtgatggtaacattggtcctgaggggcta
gtcgctactcagcaaggagacaaaggtgaggtgtatgtcaccatgtctagtttctatcag
atccagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257526
Entry
112257526         CDS       T05605                                 

Gene name
il7r
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112257526 (il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112257526 (il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:otw04050]
    112257526 (il7r)
   04090 CD molecules [BR:otw04090]
    112257526 (il7r)
Cytokine receptors [BR:otw04050]
 Interleukin receptor families
  IL2 receptor family
   112257526 (il7r)
CD molecules [BR:otw04090]
 Proteins
  112257526 (il7r)
SSDB
Motif
Pfam: FN3_7
Other DBs
NCBI-GeneID: 112257526
NCBI-ProteinID: XP_024286928
LinkDB
Position
9
AA seq 423 aa
MAYSLWIALLMLPVLVHSQSGEELVDNEPRILCTSHLSVSAANSLTCHLDDDTDDDDEME
DIKVMSLCYTDDKKQRCLKEKGNNVTFTDLDTLQSYNLTVQLKRGGTFWKTMSLKKIIKP
RSPWVVNATFLRSSNRALIYIGNPYLKDYLKPSNQLFQLHIWSVKNTLVKNITYQPLIIE
GDEYLHKNTEYHVKVRAKPSGGYFDGSWSEWSASISFSTNTETDVQVLSYSLIVPIASLL
LVTLAVGIFWRKQIHSFIWPSIPHPKHTLLQIPQTYEPMKHGPPVSFNPEVFSDLNIQLV
EPDKEQDLTSLPPDSDSHRLAEVKDQYLIQERDGDTTSCHSTSSGGSESILLRCESPGVH
LNCGARSSRNSGSTVGILDLRSDFESVETDDSDGNIGPEGLGATQQGGKDEAYVTMSSFY
QIQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcatacagcctatggattgccttactcatgctcccggttctggtgcactctcaaagt
ggagaagaattggttgacaatgaacccagaatactctgcacctctcatctcagtgtctcg
gcagcaaacagcctaacctgccaccttgatgatgacaccgatgatgatgatgaaatggag
gacataaaagtcatgagtctttgctacacagatgacaaaaagcaacgctgtttgaaagag
aaggggaataatgtcacatttacggacctggacactctgcaatcgtataatctcaccgtt
caattaaaacgaggtggcacattttggaaaacaatgagtttgaaaaaaataattaaaccc
aggagtccttgggtggtgaatgccacatttctgaggagctccaaccgggctcttatatac
attgggaatccatacctgaaggattacctgaaacccagcaatcaactgttccaacttcac
atctggagtgtcaaaaatactctggttaaaaacataacctatcagcctctgatcattgag
ggggacgagtacctccataagaacacagagtatcatgtcaaggttcgagccaagccaagc
ggagggtactttgatggcagttggagtgagtggagcgcctctatcagtttcagcaccaac
acagagacagacgtgcaggtgctttcctattctctcatcgtgcccattgcttctctgctg
ttggttactttggcagttggtattttctggagaaaacaaatacattccttcatatggcca
agcattccacatcccaaacacacacttctccagatcccccagacctatgagccaatgaag
catggcccacctgtgagctttaaccccgaggtgttcagtgacctcaacatccagctggtg
gagccggacaaggagcaagaccttacctccctaccccctgactctgactcccatcgactc
gctgaggtcaaagatcaatacctcattcaagagcgtgatggggatacgacgtcctgccat
tccaccagtagtggagggtcggagtcgatactgcttaggtgtgagtccccaggagtgcac
ctcaactgtggggcgaggagcagtaggaacagtggctccaccgtggggatcctggatctg
aggagtgactttgagagcgtggaaacagatgacagtgatggtaacattggtcctgagggg
ctaggtgctactcagcaaggaggcaaggatgaggcttatgtcaccatgtctagtttctat
cagatccagtga

DBGET integrated database retrieval system