KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219534
Entry
112219534         CDS       T05605                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1-like
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03320  PPAR signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112219534
   04150 mTOR signaling pathway
    112219534
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112219534
  09143 Cell growth and death
   04210 Apoptosis
    112219534
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219534
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112219534
   03320 PPAR signaling pathway
    112219534
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112219534
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112219534
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112219534
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   112219534
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    112219534
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo RIO1
Other DBs
NCBI-GeneID: 112219534
NCBI-ProteinID: XP_024236626
LinkDB
Position
20
AA seq 563 aa
MARATSQIYDVVPIQSSVVICSCPHPSMVRNQPDSCSPLAIPGASSSHCTSMEGPTSESR
APGKPASLGAELRAQQAPQPRKKRPEDFKFGKILGEGSFSTVVLARERATAKEYAIKILE
KRYIMKENKAQYVKRERDVMSNLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKI
GSFDETCTRFYSAEIVCALEYLHEKGIIHRDLKPENILLSEDMHIQITDFGTAKQLSSDG
KQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKI
IKLEYEFPEKFFPKAKDLVEQLLSLDPSKRIGCEDMGGYEPLRGHPFFETISWGDLHVQT
PPKLTPYLPAMSEDDEDCYGNYDDLLSQFSSMQVAQSSSSHSLSTPETIPPAPQRSSSNI
EQYIHDLDNNSFELDLLFSEEEKQLLLEKQTSRNPWHQFVENNLILKMGPVDKRKGLFAR
RRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNA
DKWCKKIQEVWRKIYHKHQNPGL
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggcaagggccacaagtcaaatttatgatgttgtgcccattcaatccagcgtggtcatc
tgttcctgtccacatccatcaatggtaagaaatcagcctgactcctgctcgccacttgcc
atcccaggcgcaagtagcagccactgtaccagcatggagggccccacctcagagtcccgg
gccccgggaaaacctgccagcctgggcgccgagctccgggcacagcaggcccctcagccg
cgcaagaagaggccagaggacttcaaattcgggaagatactgggagagggctccttctca
accgttgtccttgcaagagaacgtgcaacggcaaaagaatatgcaataaaaattttggag
aagcggtatattatgaaggagaacaaggcgcagtacgtgaaaagagaacgggatgtgatg
tcgaacctagatcatccgttcttcgtcaaactgtactttacatttcaagatgatgaaaag
ttgtattttggccttagctatgctaagaatggagagcttttgaaatatattcgcaaaatc
ggttcttttgatgagacttgcactagattctactcggctgaaattgtttgtgcactagaa
tatttgcacgagaaaggaataattcacagagaccttaaacctgagaatattttactgagc
gaagacatgcacatccaaataacagactttggaacagcaaagcagttatcttcagatggc
aaacaagcaagagcaaactcctttgtaggaactgcgcagtacgtgtctccagagctgctg
acagagaaatcggcctgcaagagctctgacctctgggcattgggatgcataatttatcag
ctagtggctgggctaccacccttcagagctggaaacgagtacctaatattccagaagata
atcaagctggagtatgaattccctgagaagttctttcccaaagctaaggatctcgttgaa
cagcttttgtcgctggacccctccaagagaattggttgcgaggatatgggagggtacgaa
cccctgaggggacacccgttcttcgagaccatctcttggggagacctccatgtgcagacg
ccccccaagctcactccatacctgccagccatgtccgaggatgacgaggactgctatgga
aactacgatgacctcctgagccagtttagcagcatgcaggtggcccagtccagctcgtcc
cactcgctctccacgcccgagaccattcccccagcgccacagaggtccagcagcaacatc
gagcagtacatccatgacctggacaacaactcgtttgagctggacctgctgttctctgag
gaggagaagcagctgctgctggaaaaacagaccagtaggaacccctggcaccagtttgtt
gagaataatttgatcctgaaaatgggcccagtggataaacggaagggtctgtttgctcgg
cggaggcagctgctccttactgaagggccacacctgtactacgtggaccctgtcaacaag
gtcctgaagggggagatcccctggtcccccgagctgcgcccagaggccaagaacttcaag
accttctttgtccacacgcccaatcgaacatactatctgatggatcccagtggaaacgct
gacaagtggtgtaagaaaatccaggaagtgtggagaaagatctaccacaagcaccagaat
cctggcctatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223683
Entry
112223683         CDS       T05605                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1-like isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03320  PPAR signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112223683
   04150 mTOR signaling pathway
    112223683
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112223683
  09143 Cell growth and death
   04210 Apoptosis
    112223683
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223683
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112223683
   03320 PPAR signaling pathway
    112223683
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112223683
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112223683
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112223683
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   112223683
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    112223683
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo RIO1
Other DBs
NCBI-GeneID: 112223683
NCBI-ProteinID: XP_024242582
LinkDB
Position
24
AA seq 561 aa
MARATSQIYDVVPIQSSVVICSCPHPSMVRNQPDSCSPLGIPGASSSHCPSMDGPTSESR
APGKPTSQGSELRQAPQPRKKRPEDFKFGKILGEGSFSTVVLAREQATAKEYAIKILEKR
HIMKENKAQYVKRERDVMSNLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGS
FDETCTRFYSAEIVCALEYLHEKGIIHRDLKPENILLSEDMHIQITDFGTAKQLSSDSKQ
ARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIVYQLVAGLPPFRAGNEYLIFQKIIK
LEYEFPEKFFPKAKDLVEQLLSLDPSKRIGCEEMGGYDPLRGHPFFETISWGDLHVQTPP
KLTPYLPAMSEDDEDCYGNYDDLLSQFSSMQVAQSSSSHSLSTPETIPPAPQRSSSNIEQ
YIHDLDNNSFELDLLFSEEEKQLLLDKQTSGNPWHQFVENNLILKMGPVDKRKGLFARRR
QLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADK
WCKKIQEVWRKIYHKHQNLGL
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcaagagctacaagtcaaatatatgatgttgtgcccattcaatccagcgttgtcatc
tgttcctgcccacatccatcaatggtaagaaatcagcccgactcctgctcgccacttggt
atcccaggcgcaagtagcagccactgtcctagcatggatggccccacctctgagtcccgg
gctccgggcaagcctaccagccagggctccgagctccggcaggccccccagccgcgcaaa
aagaggccagaggacttcaaattcggcaagatactaggagagggctcgttctcaaccgtt
gtccttgcaagagaacaggcaacggcaaaagaatatgcaataaaaattttggagaagcgg
catattatgaaggagaacaaggcacagtacgtgaaaagagaaagggatgtgatgtcaaac
ctagatcacccattctttgtcaaactctactttacatttcaagatgatgaaaagttgtat
tttggccttagctatgctaagaatggagagcttttgaaatatattcgcaaaatcggttct
tttgatgagacctgtactagattctactcggcggaaattgtttgcgcactagaatatttg
catgagaaggggattattcacagagaccttaaacctgagaatattttactgagcgaagac
atgcacatccaaataacagactttggaacagcaaagcaattatcttccgatagcaaacaa
gcgagagcgaactcctttgtaggaactgcgcagtatgtgtctccagagctgctgacagag
aaatctgcttgcaagagctctgacctctgggccttgggatgcatagtctatcagctggtg
gctgggctaccacccttcagagctggaaacgagtacctaatattccagaagataatcaag
ctggagtatgaatttccagagaagttctttcccaaagcgaaagatcttgttgaacagctt
ttgtcgctggacccctccaagagaatcggttgcgaggagatgggagggtacgaccccctg
aggggacacccgttcttcgagaccatctcctggggagacctccatgtgcagacgccaccc
aagctcaccccctacctgccagccatgtctgaggatgatgaggactgctatggaaactat
gacgacctcctgagccagttcagcagcatgcaggtggcccagtccagctcgtcccactcg
ctctccacgcctgagaccattcccccagcgccgcagaggtccagcagcaacatcgagcag
tacatccacgacctggacaacaactcgtttgagctggacctgctgttctccgaggaggag
aagcagctgctgctggacaaacagacgagtggaaacccctggcaccagtttgttgagaat
aatttgatcctgaaaatgggcccagtggataaacggaagggcctgtttgctcgacggaga
cagctgctcctcactgaagggccacacctgtactacgtggaccctgtcaacaaggtcctg
aagggggagatcccctggtcccctgagctgcgtccagaggccaagaactttaagaccttc
tttgtccacacgcccaatcgaacatactatctgatggacccgagtggaaatgcagacaag
tggtgtaagaagatccaggaagtgtggagaaagatctatcacaagcaccaaaatcttggc
ctatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224117
Entry
112224117         CDS       T05605                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1-like
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03320  PPAR signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04510  Focal adhesion
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112224117
   04150 mTOR signaling pathway
    112224117
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112224117
  09143 Cell growth and death
   04210 Apoptosis
    112224117
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224117
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112224117
   03320 PPAR signaling pathway
    112224117
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112224117
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112224117
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112224117
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   112224117
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    112224117
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo RIO1
Other DBs
NCBI-GeneID: 112224117
NCBI-ProteinID: XP_024243201
LinkDB
Position
25
AA seq 563 aa
MARATSQIYDVVPIQSSVVICSCPHPSMVRNQPDSCSPLAIPGASSSHCTSMEGPTSESR
APGKPASLGAELRAQQAPQPRKKRPEDFKFGKILGEGSFSTVVLARERATAKEYAIKILE
KRYIMKENKAQYVKRERDVMSNLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKI
GSFDETCTRFYSAEIVCALEYLHEKGIIHRDLKPENILLSEDMHIQITDFGTAKQLSSDG
KQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKI
IKLEYEFPEKFFPKAKDLVEQLLSLDPSKRIGCEDMGGYEPLRGHPFFETISWGDLHVQT
PPKLTPYLPAMSEDDEDCYGNYDDLLSQFSSMQVAQSSSSHSLSTPETIPPAPQRSSSNI
EQYIHDLDNNSFELDLLFSEEEKQLLLEKQTSRNPWHQFVENNLILKMGPVDKRKGLFAR
RRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNA
DKWCKKIQEVWRKIYHKHQNPGL
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggcaagggccacaagtcaaatttatgatgttgtgcccattcaatccagcgtggtcatc
tgttcctgtccacatccatcaatggtaagaaatcagcctgactcctgctcgccacttgcc
atcccaggcgcaagtagcagccactgtaccagcatggagggccccacctcagagtcccgg
gccccgggaaaacctgccagcctgggcgccgagctccgggcacagcaggcccctcagccg
cgcaagaagaggccagaggacttcaaattcgggaagatactgggagagggctccttctca
accgttgtccttgcaagagaacgtgcaacggcaaaagaatatgcaataaaaattttggag
aagcggtatattatgaaggagaacaaggcgcagtacgtgaaaagagaacgggatgtgatg
tcgaacctagatcatccgttcttcgtcaaactgtactttacatttcaagatgatgaaaag
ttgtattttggccttagctatgctaagaatggagagcttttgaaatatattcgcaaaatc
ggttcttttgatgagacttgcactagattctactcggctgaaattgtttgtgcactagaa
tatttgcacgagaaaggaataattcacagagaccttaaacctgagaatattttactgagc
gaagacatgcacatccaaataacagactttggaacagcaaagcagttatcttcagatggc
aaacaagcaagagcaaactcctttgtaggaactgcgcagtacgtgtctccagagctgctg
acagagaaatcggcctgcaagagctctgacctctgggcattgggatgcataatttatcag
ctagtggctgggctaccacccttcagagctggaaacgagtacctaatattccagaagata
atcaagctggagtatgaattccctgagaagttctttcccaaagctaaggatctcgttgaa
cagcttttgtcgctggacccctccaagagaattggttgcgaggatatgggagggtacgaa
cccctgaggggacacccgttcttcgagaccatctcttggggagacctccatgtgcagacg
ccccccaagctcactccatacctgccagccatgtccgaggatgacgaggactgctatgga
aactacgatgacctcctgagccagtttagcagcatgcaggtggcccagtccagctcgtcc
cactcgctctccacgcccgagaccattcccccagcgccacagaggtccagcagcaacatc
gagcagtacatccatgacctggacaacaactcgtttgagctggacctgctgttctctgag
gaggagaagcagctgctgctggaaaaacagaccagtaggaacccctggcaccagtttgtt
gagaataatttgatcctgaaaatgggcccagtggataaacggaagggtctgtttgctcgg
cggaggcagctgctccttactgaagggccacacctgtactacgtggaccctgtcaacaag
gtcctgaagggggagatcccctggtcccccgagctgcgcccagaggccaagaacttcaag
accttctttgtccacacgcccaatcgaacatactatctgatggatcccagtggaaacgct
gacaagtggtgtaagaaaatccaggaagtgtggagaaagatctaccacaagcaccagaat
cctggcctatag

DBGET integrated database retrieval system