KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219617
Entry
112219617         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112219617
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112219617
   04012 ErbB signaling pathway
    112219617
   04310 Wnt signaling pathway
    112219617
   04068 FoxO signaling pathway
    112219617
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112219617
   04137 Mitophagy - animal
    112219617
  09143 Cell growth and death
   04210 Apoptosis
    112219617
   04217 Necroptosis
    112219617
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219617
   04530 Tight junction
    112219617
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112219617
   04621 NOD-like receptor signaling pathway
    112219617
   04622 RIG-I-like receptor signaling pathway
    112219617
   04625 C-type lectin receptor signaling pathway
    112219617
  09152 Endocrine system
   04910 Insulin signaling pathway
    112219617
   04920 Adipocytokine signaling pathway
    112219617
   04912 GnRH signaling pathway
    112219617
   04914 Progesterone-mediated oocyte maturation
    112219617
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112219617
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112219617
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112219617
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112219617
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 112219617
NCBI-ProteinID: XP_024236787
LinkDB
Position
20
AA seq 476 aa
MVFMSRHFFYYCGEPVLDVKIAFCQGFGKQLDVSYIGKHYNMSKCKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEDFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRIQVDEALQHP
YINVWYDPAEVEAARDLVQISMPPPAIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNG
VVKGQPSPSGAAVNSSGESLPSPSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtatttatgagcaggcatttcttctattactgcggtgaaccagtcctagatgtgaaa
atagccttttgtcagggttttggtaaacaattggatgtgtcatacattggcaagcattac
aacatgagcaaatgcaaagtggacaaccagttctacagtgtggaagtaggagattccacc
ttcacagttctcaaacgttaccagaatctaaaacccatcggttctggagctcagggaatc
gtctgtgccgggtacgatgcagtcctcgacagaaacgtggccatcaagaagctcagcaga
ccctttcagaaccagacccatgccaagagggcatacagggaactggtgctcatgaaatgt
gtcaatcacaaaaatatcatcagtttattaaatgttttcacaccacagaaatcactagaa
gactttcaggatgtgtacctggtgatggagctgatggatgcaaacctatgccaggtgatt
cagatggagctagaccatgagagaatgtcctacctgctctaccagatgctgtgtggcatc
aaacacctgcactcagctggaattatacacagggacctgaaacctagcaatatagtggtg
aagtctgattgtacgctgaagatcctggactttggcctggcaaggactgcaggcacaagc
ttcatgatgaccccgtacgtggtgacacggtactacagagctccagaggtcatcctgggc
atggggtacaaagagaacgtggatatatggtcggtggggtgcattatgggagaaatggtg
cgtcacaaaatcctgttccctggccgtgactatatcgaccaatggaataaagtgattgag
cagctgggcacaccctcaccagagtttatgaagaagctgcagcccactgtccgtaactat
gtagagaacagacccaaatacgcaggcctcacctttcccaagctcttccccgactgcctc
ttccctgcagactcagagcacaacaaactcaaagctagccaggccagagatctgttgtct
aagatgttgattattgatccagccaagcggatacaagtggacgaagccttacagcacccc
tacatcaacgtttggtacgacccagccgaggtggaggcggccagggatctcgtccaaata
tcaatgcctcctcctgctatctacgacaaacagctggatgagagagaacactctatcgat
gaatggaaagaactaatctacaaagaggtgatgaactttgaggagaggacgaagaacggg
gtggtgaagggacaaccctctccctcaggtgcagccgtgaacagcagtggtgagagcctc
ccttccccctccgtcaacgatatctcctccatgtccaccgaccagaccctggcctcagac
actgacagcagcctggagacctccgcaggacccctggggtgttgcaggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220751
Entry
112220751         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112220751
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112220751
   04012 ErbB signaling pathway
    112220751
   04310 Wnt signaling pathway
    112220751
   04068 FoxO signaling pathway
    112220751
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112220751
   04137 Mitophagy - animal
    112220751
  09143 Cell growth and death
   04210 Apoptosis
    112220751
   04217 Necroptosis
    112220751
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220751
   04530 Tight junction
    112220751
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112220751
   04621 NOD-like receptor signaling pathway
    112220751
   04622 RIG-I-like receptor signaling pathway
    112220751
   04625 C-type lectin receptor signaling pathway
    112220751
  09152 Endocrine system
   04910 Insulin signaling pathway
    112220751
   04920 Adipocytokine signaling pathway
    112220751
   04912 GnRH signaling pathway
    112220751
   04914 Progesterone-mediated oocyte maturation
    112220751
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112220751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112220751
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112220751
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112220751
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 112220751
NCBI-ProteinID: XP_024238389
LinkDB
Position
21
AA seq 419 aa
MSVDEGQFYSVQVGDSTFTVLKRYQELRAIGSGAQGIVCSALDSVLGFPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGNVIFQGTDHIDQWNKVIEVLG
TPSMEFMNRLMETVRNYVMNKPQYPGVNFAELFPDWAFPSDSEHDRLKTGQARDLLSKML
VIDPESRISVEEALNHPYIHVWYDPGEADAPPPQICDKQLEEREHSIEQWKELIYEELID
WEERNKNGVTKDESDAVRGLASQSSSANDISSMSTEQTLASDTDSSSIDTLTGHLGESQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagtgtggatgagggccagttctacagtgtgcaggtgggagactccaccttcactgtt
ctgaagcgctaccaggagctcagggccatcggctccggggcacagggcattgtctgctct
gctctagactcagtgttaggttttcccgtggcagtaaagaagctgtgtcggccattccag
aaccagactcatgccaagcgggcctacagggaactggtgctgctcaaatgtgtcaaccac
aaaaacattatcaggttgatcaatgtgttcacgcctcagaagtcactggaggagtttcag
gacctctacctagtgatggagctaatggatgccagtctgtgccaggtgatccacatggac
ctggaccatgagaggatgtcctacctgctctaccagatcctctgtggcatcagacacctg
cactccgctggcatcatccacagggatctgaagcccagtaacatagtggtcaagtcggac
tgtactctgaagatcctggactttggattggccagaacggcctgcactaacttcatgatg
accccttatgtggtgactaggtactacagggccccagaggtcatcctgggcatgaagtac
aaggagaacgtggacatctggtcagtggggtgcatcatgggtgaaatggtgaagggcaac
gttatcttccagggcaccgaccacatagaccagtggaacaaggtgattgaggtgctgggt
actccctccatggagtttatgaaccggctgatggagactgtgaggaactatgtgatgaac
aagcctcaatacccaggggtgaacttcgctgaactatttcctgactgggccttcccctct
gattccgaacacgacagactcaagacgggtcaagctcgggacctgctgtccaaaatgcta
gtgatcgatcccgagagccgcatctcagtagaagaggccctgaatcacccgtatatccac
gtgtggtacgatccaggagaggcagatgcgcctcccccacagatctgtgacaagcagcta
gaggagagagaacacagcatcgaacagtggaaagagctcatttatgaagaattgatagac
tgggaggagaggaacaagaacggcgtgacgaaagacgagtcagatgcagtgagggggttg
gcttcccagtcgtcctcggccaatgacatctcgtccatgtcaacagagcaaaccctggcc
tccgacactgacagcagcagcattgacacactcactggacacctgggcgagagccaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223506
Entry
112223506         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112223506
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112223506
   04012 ErbB signaling pathway
    112223506
   04310 Wnt signaling pathway
    112223506
   04068 FoxO signaling pathway
    112223506
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112223506
   04137 Mitophagy - animal
    112223506
  09143 Cell growth and death
   04210 Apoptosis
    112223506
   04217 Necroptosis
    112223506
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223506
   04530 Tight junction
    112223506
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112223506
   04621 NOD-like receptor signaling pathway
    112223506
   04622 RIG-I-like receptor signaling pathway
    112223506
   04625 C-type lectin receptor signaling pathway
    112223506
  09152 Endocrine system
   04910 Insulin signaling pathway
    112223506
   04920 Adipocytokine signaling pathway
    112223506
   04912 GnRH signaling pathway
    112223506
   04914 Progesterone-mediated oocyte maturation
    112223506
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112223506
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112223506
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112223506
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112223506
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 112223506
NCBI-ProteinID: XP_024242326
LinkDB
Position
24
AA seq 434 aa
MNRNKREKEYYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYIVMDLMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGYTFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVSEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKDLIYMEV
QDWEERTKNGVIRGQPASLGSTGAAVSSSFQQHPSASSSSANDVSSMSTDPTLASDTDSS
LETASNTDPLGCCR
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaatcggaataagcgtgaaaaggagtattacagtttagatgtcggggattccactttt
acggttttgaagcgctaccagaatttaagacccataggctccggagcacaagggattgtc
tgctcagcgtatgaccacaaccttgaacgaaatgtggcaattaaaaaactcagccggcct
ttccagaaccagacccatgccaaaagagcttacagagaactggtgctcatgaaatgtgtc
aaccataagaacatcattggcctattaaatgtattcacgccacagaagacgctggaagaa
tttcaagatgtgtatattgtgatggatctgatggatgccaacctgtgccaggtgattcag
atggagctggaccacgagcggctgtcctatctgctctaccagatgctgtgtggcatcaag
caccttcacgccgcgggcatcatacacagggatctgaaacccagcaacattgtggtaaag
tctgactgcacgctaaagatcctggactttggattggccaggacagcggccacgggactc
ctgatgaccccgtacgtggtgacccgctactaccgcgcccctgaagtcatattgggcatg
ggttaccaggccaacgttgatgtctggtctattggctgcatcatggcagaaatggtccga
ggtagtgtgttgttcccaggcacagatcatattgatcagtggaacaaggtgatcgagcag
ctggggactccaagtcaggagttcctgatgaagctcaaccagtcagtgaggacttatgtg
gaaaacagaccccgctatgccggctataccttcgagaagctcttccccgacgtcctcttc
ccagccgactcagagcacaacaaactgaaagcaagtcaagccagagacctattatcgaag
atgctggtaatagatgcatccaaacggatctctgtgagcgaggctctccagcacccctac
atcaacgtgtggtatgatccaactgaagtggaggcgcccccaccactgatcacagacaag
cagctggatgagagggagcacacggtggaggagtggaaagatttgatatacatggaggtt
caggactgggaggagagaacgaagaatggagtgatccggggacagccagcgtctttaggt
agcacaggtgcagcagtgagcagcagcttccagcagcacccttctgcgtcgtcctcgtcc
gccaacgatgtgtcctccatgtccaccgaccccaccctggcctcggacacagacagcagc
ctggagacagcctctaacacggacccgctgggctgctgcagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224208
Entry
112224208         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 8-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112224208
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112224208
   04012 ErbB signaling pathway
    112224208
   04310 Wnt signaling pathway
    112224208
   04068 FoxO signaling pathway
    112224208
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112224208
   04137 Mitophagy - animal
    112224208
  09143 Cell growth and death
   04210 Apoptosis
    112224208
   04217 Necroptosis
    112224208
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224208
   04530 Tight junction
    112224208
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112224208
   04621 NOD-like receptor signaling pathway
    112224208
   04622 RIG-I-like receptor signaling pathway
    112224208
   04625 C-type lectin receptor signaling pathway
    112224208
  09152 Endocrine system
   04910 Insulin signaling pathway
    112224208
   04920 Adipocytokine signaling pathway
    112224208
   04912 GnRH signaling pathway
    112224208
   04914 Progesterone-mediated oocyte maturation
    112224208
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112224208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112224208
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112224208
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112224208
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 112224208
NCBI-ProteinID: XP_024243383
LinkDB
Position
25
AA seq 428 aa
MNRNKREKEFYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYIVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGFTFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVSEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKDLIYMEV
QDWEERTKNGVIRGQPASLGAAVSSGSQQDPSVSSSSVNDVSTDPTLASDTDSSLETASN
TDPLGCCR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaatcggaataagcgcgaaaaggagttttacagtttagatgtcggtgattccacgttt
acggttttgaagcgctaccagaatttaagacccatcggctccggagcacaagggattgtc
tgctcagcgtatgaccacaacctcgaacgcaatgttgcaattaaaaaactcagccgccct
ttccagaaccagacccatgccaaaagagcttacagagaactggtgctcatgaaatgtgtc
aaccataagaacattattggcttgctaaatgtattcacgccacagaagacactggaggag
ttccaagatgtttatattgtgatggagctgatggatgccaacctgtgccaggtgatccag
atggagctggaccacgagcggctgtcctatctgctctaccagatgctgtgtggcatcaag
caccttcacgccgcgggcatcatacacagggatctgaaacccagcaacattgtggttaag
tcggactgcacactgaagatcctggacttcggattggccaggacagcagccacaggcctc
ctgatgaccccgtacgtggtgacccgctactaccgcgcccctgaagtcatcttgggcatg
ggttaccaggccaatgttgatgtctggtctattggctgcatcatggcagaaatggtccga
ggtagtgtgttgttcccaggcacagatcatattgatcagtggaacaaggtgatcgagcag
ttggggactcccagtcaggagttcctgatgaagctcaaccagtcggtaaggacctacgtg
gagaacagaccccgctacgccgggttcacctttgagaagctcttccccgacgtcctcttc
ccagccgactcggagcacaacaaactgaaagcaagtcaagccagagacctattatcaaag
atgttggtaatagatgcatccaaacggatctctgtgagcgaggctctccagcacccctac
atcaacgtgtggtatgatccaactgaagtggaggcgcccccaccgttgatcactgacaag
cagctggatgagagggaacacacagtggaggagtggaaagatttgatatacatggaggtc
caggactgggaggagagaacgaagaatggagtgatccggggacagccagcgtctttaggt
gcagcagtgagcagcggctcccagcaggacccttctgtatcgtcctcgtccgtcaacgat
gtgtccaccgaccccaccctggcttccgacacggacagcagcctggagacagcctctaac
acggacccactgggctgctgcagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231415
Entry
112231415         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112231415
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112231415
   04012 ErbB signaling pathway
    112231415
   04310 Wnt signaling pathway
    112231415
   04068 FoxO signaling pathway
    112231415
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112231415
   04137 Mitophagy - animal
    112231415
  09143 Cell growth and death
   04210 Apoptosis
    112231415
   04217 Necroptosis
    112231415
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112231415
   04530 Tight junction
    112231415
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112231415
   04621 NOD-like receptor signaling pathway
    112231415
   04622 RIG-I-like receptor signaling pathway
    112231415
   04625 C-type lectin receptor signaling pathway
    112231415
  09152 Endocrine system
   04910 Insulin signaling pathway
    112231415
   04920 Adipocytokine signaling pathway
    112231415
   04912 GnRH signaling pathway
    112231415
   04914 Progesterone-mediated oocyte maturation
    112231415
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112231415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112231415
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112231415
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112231415
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 112231415
NCBI-ProteinID: XP_024253925
LinkDB
Position
33
AA seq 520 aa
MHARSWYCEELSQQHPFACLRPTSHATDRTATFSAKLQGNINTKSPISLNIPSGTILLLD
TSGAATFHLVIGCTHGSDPAKEKAEGCILFVSGSTGGGAMSEGEGLFHSVQVGDSTFTVL
TRYQQLRAIGSGAQGIVCSALDSVLGVPVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHK
NIIRLLNVFTPQNSLEEFQDLYLVMELMDASLCQVIHMDLDHERMSYLLYQILCGIRHLH
SAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMKYK
ENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLGTPPMEFMNRLMETVRNYVMNK
PQYPGVSFSQLFPDWAFPAETEQDQLKTSQARDLLSKMLVIDPESRISVEDALDHPYIHM
WYDPGEADAPPPQISDKQLEEREHSIEQWKELIYDELMDWEERNQNGVMKEDCADEVVNH
SATASQSSSTSDFSSMSTEQTLASDTDSSCVDTLTGALEE
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcacgctcgctcgtggtactgtgaggaattgtcccagcagcaccccttcgcctgcctc
cgccccaccagtcatgctacggacaggaccgcaacattttcagccaaactacaaggaaac
ataaacacaaagtctccaatttcactgaacataccaagtggaacgattcttcttctagac
acatctggtgccgcgacatttcatttggttatcggatgtacgcatgggagtgatccggca
aaagaaaaggcagaaggttgtatcctattcgttagtggcagcacagggggaggagccatg
agtgaaggggaggggctcttccacagcgtgcaggtgggtgactccaccttcactgtgctg
acccgctatcagcagctccgcgctatcgggtctggtgcccagggcattgtctgctcggcc
ctggacagtgtccttggggtcccagtggcggtgaagaaactgagccggcccttccagaac
cagacccacgccaagcgggcctatagggagctggtgctgctcaagtgcgtcaatcacaaa
aatattattaggctcctgaatgtcttcacaccacagaattcactggaggagttccaggat
ctctacctggtgatggagttgatggatgccagtctgtgccaggtcatccacatggatctg
gaccatgagaggatgtcctacctgctctaccagatcctctgtggcatcagacacctgcac
tccgctggcattatccacagggacctgaagcccagtaacatagtggtgaagtctgactgt
actctgaagatcctggactttgggctggccagaacagcctgtactaacttcatgatgacc
ccttacgttgtgacccgatactatagagcaccagaggtcatcctgggcatgaagtataaa
gagaatgtggacatctggtcagtgggatgcatcatgggagagatggtgaagggcagcgtt
atattccagggaacggatcacattgaccagtggaacaaggtgattgaggttctgggcacg
ccccccatggagtttatgaaccgtttgatggagactgtgaggaactatgtgatgaacaag
ccccagtacccaggggtcagcttctctcaactcttccctgactgggccttcccggcagag
acagagcaggatcaactcaagaccagtcaagcacgggacctgctttccaagatgctggtg
attgacccagagagccgtatttcagtggaggatgccctggatcacccctacatccacatg
tggtacgacccaggagaggctgatgcaccaccaccacagatatctgataaacagctggag
gagcgagaacacagcattgaacagtggaaagagctgatctatgacgagttgatggactgg
gaggagaggaaccagaatggagtaatgaaggaggactgtgcagatgaagtggtgaaccac
agtgctacagcttcccagtcatcctctacgagtgacttctcctcaatgtccactgagcag
accttggcctctgacaccgacagcagctgtgttgacaccctcacaggggcgctagaggag
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252352
Entry
112252352         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112252352
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252352
   04012 ErbB signaling pathway
    112252352
   04310 Wnt signaling pathway
    112252352
   04068 FoxO signaling pathway
    112252352
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112252352
   04137 Mitophagy - animal
    112252352
  09143 Cell growth and death
   04210 Apoptosis
    112252352
   04217 Necroptosis
    112252352
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252352
   04530 Tight junction
    112252352
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112252352
   04621 NOD-like receptor signaling pathway
    112252352
   04622 RIG-I-like receptor signaling pathway
    112252352
   04625 C-type lectin receptor signaling pathway
    112252352
  09152 Endocrine system
   04910 Insulin signaling pathway
    112252352
   04920 Adipocytokine signaling pathway
    112252352
   04912 GnRH signaling pathway
    112252352
   04914 Progesterone-mediated oocyte maturation
    112252352
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112252352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252352
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112252352
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112252352
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 112252352
NCBI-ProteinID: XP_024279262
LinkDB
Position
1
AA seq 438 aa
MNKNKRAEERELYSLDVGDSTFTVLKCYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLS
RPFQNQTHAKRAYRELVLMKCVNHKNIIGLINVFSPQKSLEEFADVYIVMELMDANLCQV
IQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAAT
GLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMIRHKILFPGRDYIDQWNKVI
EQLGTPPQEFLMKLNQSVRTYVENRPRYAGYSFDKLFPDVLFPADSEHNKLKASQARDLL
SKMLVIDSSKRISVDEALKHPYINVWYDPAEVEAPPPKITDKQLDEREHTVEEWKDLIWK
EVYEWDDWTKQNGVIRGQPLLGAAVIDSSPQHPSSSSSGNDVSSMSTDPSDPSEPSMTSD
TDSSLDSHTSLGALACCR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaataaaaacaagcgagcagaagagagggagctttacagtttagatgtcggagattcc
accttcactgttctgaaatgctaccagaatctaaggcccatcggctcaggagcacaggga
atcgtctgttcagcgtatgaccacaaccttgagagaaatgtggctattaagaagttaagt
cggccgttccagaaccagacgcatgccaagagagcgtacagagaactggtgttaatgaaa
tgtgtcaatcacaaaaatatcattggcctaataaacgtattcagcccacaaaaatcatta
gaagaatttgcagatgtatacattgtgatggagctgatggatgccaacttgtgccaggtg
attcagatggagctggatcatgagaggttgtcctacctgctctaccagatgctgtgtggc
atcaaacacctccacgctgccggcatcatacacagggatctaaagcccagtaacattgtc
gtgaagtcagactgtacgttgaagatcttggactttggcttggctcggacggcggctaca
ggtctgctgatgaccccctacgtagtgaccagatactacagagcaccagaggtcatactg
gggatgggctaccaggccaacgtggacatatggtctgtgggatgtattctggcagaaatg
atccgccacaaaatcctgttcccaggaagggactacattgaccagtggaacaaggtgata
gagcagcttgggactccaccacaggagttcctgatgaagctcaaccaatcagtgaggacg
tacgtagagaacaggccgcgttacgcaggatacagctttgacaaactcttccctgatgtc
ctcttccctgcagactcagagcacaacaaactgaaagcgagccaggccagagacctgctg
tctaagatgttggtgatcgactcgtctaagaggatctctgtggacgaggccctgaaacac
ccctatatcaacgtgtggtatgacccagcagaagtggaggcgccccctccgaagatcaca
gacaagcagctggatgagcgagagcatacggtggaggagtggaaagacctgatctggaag
gaggtgtatgagtgggacgattggaccaagcagaatggcgtgatcagaggacaacctctt
ttaggtgcagcagtgattgacagctcccctcagcacccctcgtcctcctcctcaggcaat
gacgtatcctccatgtcgactgaccccagtgaccctagtgaacccagcatgacctctgac
acggacagcagcctggacagccacacctctctgggagcactggcctgctgcagataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252764
Entry
112252764         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112252764
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252764
   04012 ErbB signaling pathway
    112252764
   04310 Wnt signaling pathway
    112252764
   04068 FoxO signaling pathway
    112252764
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112252764
   04137 Mitophagy - animal
    112252764
  09143 Cell growth and death
   04210 Apoptosis
    112252764
   04217 Necroptosis
    112252764
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252764
   04530 Tight junction
    112252764
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112252764
   04621 NOD-like receptor signaling pathway
    112252764
   04622 RIG-I-like receptor signaling pathway
    112252764
   04625 C-type lectin receptor signaling pathway
    112252764
  09152 Endocrine system
   04910 Insulin signaling pathway
    112252764
   04920 Adipocytokine signaling pathway
    112252764
   04912 GnRH signaling pathway
    112252764
   04914 Progesterone-mediated oocyte maturation
    112252764
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112252764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252764
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112252764
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112252764
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 112252764
NCBI-ProteinID: XP_024280079
LinkDB
Position
6
AA seq 436 aa
MNKNKRGGEREFYSLDVGDSTFKVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLS
RPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFSPQKSLEEFADVYIVMELMDANLCQV
IQMELDHERLSYLLYQMLCGIKHLHNAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAAT
GLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVI
EQLGTPPQEFLMKLNQSVRTYVENRPRYAGYSFDKLFPDVLFPADSEHNKLKASQARDLL
SKMLVIDSSKRISVDEALKHPYINVWYDPAEVEAPPPKITDKQLDEREHTVEEWKDLIWK
EVYEWDEWTKQNGVIRGQPPPLGAAVIDSSPQPASSSSSANDVSSMSTEPSDPTMTSDTD
ISLDSHTSLGALACCR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaataaaaacaagcgaggaggagagagggagttctatagtttagatgtcggagattcc
accttcaaagttctgaagcgctaccagaatctaaggcccattggctcaggagcacaggga
atagtctgttcagcgtatgaccacaaccttgagagaaatgtggctattaagaagttgagt
cggccgttccagaaccagacgcacgccaagcgagcgtacagagaactggtgttaatgaaa
tgtgtcaatcacaaaaatatcattggcttattaaacgtattcagcccacaaaaatcatta
gaagaatttgcagatgtatacattgtgatggagctgatggatgccaacctgtgccaggtg
attcagatggagctggaccatgagaggttgtcctacctgctgtaccagatgctgtgtggc
atcaaacacctccacaatgccggcatcatacacagggatctgaagcccagtaacattgtg
gtgaagtcagactgtacattaaagatcttggactttggcttggctcgaacagcggctaca
ggtttactgatgaccccctatgtagtgaccagatactacagagcaccagaggtcatactg
gggatgggctaccaggccaatgtggacatatggtctgtggggtgtattctggcagaaatg
gtccgtcacaaaatcctgttcccaggaagggactacattgaccagtggaacaaagtgata
gagcagcttgggactccgccccaggagttcctgatgaagctcaaccaatcagtgaggacg
tatgttgagaaccgaccgcgctacgcaggatacagcttcgacaaactcttcccggacgtc
ctcttccctgcagactcagaacacaacaaactgaaagcgagccaggccagagacctgctg
tctaagatgttggtgattgactcgtctaagaggatctcggtggacgaggccctgaaacac
ccctatatcaacgtgtggtacgacccagcagaagtggaggcaccccctccaaagatcaca
gacaagcagctggatgagcgagagcatacagtggaggagtggaaagacctgatctggaag
gaggtgtatgagtgggatgagtggaccaagcagaatggagtgatcagaggacaacctcct
cctttaggtgcagcagtgattgacagctcccctcagcccgcctcatcctcctcctcggcc
aatgacgtatcctccatgtcgactgagccaagtgaccccaccatgacctctgacacggac
atcagcctggacagccacacctccctgggagcactggcctgctgcagataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257338
Entry
112257338         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 10-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112257338
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112257338
   04012 ErbB signaling pathway
    112257338
   04310 Wnt signaling pathway
    112257338
   04068 FoxO signaling pathway
    112257338
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112257338
   04137 Mitophagy - animal
    112257338
  09143 Cell growth and death
   04210 Apoptosis
    112257338
   04217 Necroptosis
    112257338
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257338
   04530 Tight junction
    112257338
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112257338
   04621 NOD-like receptor signaling pathway
    112257338
   04622 RIG-I-like receptor signaling pathway
    112257338
   04625 C-type lectin receptor signaling pathway
    112257338
  09152 Endocrine system
   04910 Insulin signaling pathway
    112257338
   04920 Adipocytokine signaling pathway
    112257338
   04912 GnRH signaling pathway
    112257338
   04914 Progesterone-mediated oocyte maturation
    112257338
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112257338
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112257338
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112257338
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112257338
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH RIO1 FTA2
Other DBs
NCBI-GeneID: 112257338
NCBI-ProteinID: XP_024286599
LinkDB
Position
9
AA seq 476 aa
MVFMRSDFFYYCSEPVLDVKIAFCQGFGKQVDVSYIVKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGSDSVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEDFQDVYLCMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDMWSVGCIFGEVIRGTVLFPGTDHIDQWNKVIEQLGTPAPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLCKMLIIDPAKRIQVDEALQHP
YINVWYDPAEVEAARDLVQISMPPPAIYDKQLDEREHSIDEWKELIYKEVMNFEERTRNG
VVKGQPSTSGAAVNSSGESLPSPSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtatttatgaggagtgatttcttctattactgcagtgaacctgtcctggatgtgaaa
atagccttttgtcagggttttggtaaacaagtggatgtgtcatatatcgtcaaacactac
aacatgtctaaaagcaaagtggacaaccagttctacagcgtggaagtaggagattccacc
ttcacagttctcaaacgctaccagaatctaaaacccatcggttctggagctcagggaatc
gtttgtgccgggtccgattcggtcctcgacaggaacgtggccatcaagaagctcagcaga
ccctttcagaaccagacccatgccaagagggcatacagggaactggtgctcatgaaatgt
gtcaatcacaaaaacatcatcagtttattaaatgttttcacaccacagaaatcattagaa
gacttccaggatgtgtacctgtgcatggagctgatggatgccaacctgtgccaggtgatc
cagatggagctggaccatgagagaatgtcttacctgctctaccagatgctgtgtggaatc
aaacacctgcactccgcgggcatcattcacagggacctgaaacctagcaatatagtggtg
aaatctgattgtactctgaagatcctggactttggcttggctaggactgcaggcaccagc
ttcatgatgaccccgtacgtggtgacgcggtactacagagccccagaggtcatcctgggc
atggggtacaaagagaacgtggacatgtggtctgtgggctgcatctttggagaggtgata
agagggacagtgctgttcccaggcaccgaccatattgaccaatggaataaggtgattgag
cagctgggcacgcctgcgccagagtttatgaagaaactgcagcccaccgtccgtaactat
gtagagaacaggcccaaatacgcaggcctcaccttccccaagctcttccccgactgcctc
ttccccgcagactcagagcacaacaaactcaaagccagccaggccagagacctgttgtgt
aagatgttgattattgatccagccaagcggatacaagtggacgaagctttacagcacccc
tacatcaacgtttggtacgacccagccgaggtggaggcggccagggatctcgtccaaata
tctatgccgcctcctgctatctacgacaagcagctggatgagagagaacactccatcgat
gaatggaaagaactaatctacaaagaggtgatgaactttgaggagaggacgaggaacggg
gtggtgaagggacaaccctctacctcaggtgcagccgtgaacagcagtggtgagagcctc
ccttccccctccgtcaacgatatctcctccatgtccaccgaccagaccctggcctcagac
accgacagcagcctggagacctctgcaggacccctgggttgttgcaggtga

DBGET integrated database retrieval system