KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219708Help
Entry
112219708         CDS       T05605                                 

Definition
(RefSeq) neurogenic locus notch homolog protein 1-like
  KO
K02599  Notch 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    112219708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch NOD DUF3454 Ank NODP Ank_5 EGF_2 Ank_3 Ank_4 cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 112219708
NCBI-ProteinID: XP_024236984
LinkDB All DBs
Position
20
AA seq 2488 aa AA seqDB search
MYRFFVKLTFLIPVIVITQGLRCSLTTESCLNGGRCEASSDRNGECRCTSDYVGSRCQYS
NPCNPSPCRNGGECRAVSHGNTFEFHCKCRLGFSDQLCLTPTNHACMSSPCRNGGTCDLI
TLSDYRCRCPPGWSGKTCQIANPCASNPCANGGQCSPFESHYICACLPAFHGQTCKLDVN
ECAQMSSPCRNGGMCVNEVGSYHCRCPQEYTGANCETPYMPCNPSPCHSGGTCVQKGDTS
YDCSCLPGFTSQNCDHNIDDCPGHNCQNGGLCVDGVNTYNCQCPPHFTGQFCTENVDECE
MMPNTCQNGGTCHDTYGSFHCVCVNGWTGDDCSENIDDCASAACYHGATCHDRVASFFCE
CPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNQDIDECSLGA
NPCEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECMSNPCQNDATCLDQIGGFHCICMP
GYEGVFCQINTDECASMPCLNNGKCIDRINSFHCECHKGFSGGLCQVDIDECASTPCMNG
AKCTDGPNKYSCECTEGYSGQHCETDINECYSDPCHYGTCKDGLATFTCYCHPGYTGRLC
ETNINECLSQPCQNGGTCQDRENTYICTCPKGTAGFNCEVNLDDCKSKPCDYGRCIDKIN
SYECACEPGYAGAMCNINTDECAINPCHNGGTCIDGINSFTCLCPEGYSDATCLLQVDEC
GSNPCIHGRCQDLLNGYRCVCDSGWGGPNCDINNNECESNPCMNGGTCKDMTSGYVCSCR
AGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGEMCETLLAPCSPMQPCK
NSGVCHESEDYQSFSCLCPEGWQGQTCEIDINECVKSPCRSGATCHNMVGSYRCSCRPGY
TGQKCETDIDDCKPNPCSNGGLCRDGVDSFVCTCLPGFRGGRCEHDINECESNPCKNGAN
CTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFTCLCLPGFTGSYCQ
HDINECDSKPCLNGGTCLDSYGTYKCTCSHGYTGVNCQNLVRWCDSSPCKNGGSCWQQGS
SYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVGHLCRNSGQCLDAGNTHYCRCQAGYMG
SYCQEQVDECSPNPCQNGATCTDYLGGYSCECLPGYHGVNCSKEINECLSQPCQHGGTCI
DLINTYKCSCPRGTQGIHCEINLDDCNPSTDPLTNEPKCFNKGQCVDRVGGYHCMCPAGY
VGERCEGDVNECLSDPCDLRGSYNCVQLTNSYRCECRTGYTGQRCDKVFDGCKGRPCRNG
GMCAVASNNPDGFICKCPPGYTGSSCEYDSRFCGSLNCRNGGTCVSGHLSPRCLCPTAFT
GPECQTPTNSPCNVNHCYNGGTCQRTPDAPFFHCSCPNNFNGLLCHILDYSFPGGFGRDI
TPPPEVEVSCEIPQCDEWAGNHICDSLCNNHACGWDGGDCSLNFDDPWQNCSAALQCWRY
FNDGKCDEQCKSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGHCDQGCNNAECEWDGL
DCANNMPEKLADGHLVLVVHIPPEQLKNGLSTFLRELSSVLHTNVVFRRDANGEPMVFPY
YGSEQELAKHNVKRSTDSWPDWAVVPANMLGQVKESVGSMVNLPRQRRELDLMQVKGSVV
YLEIDNRQCYQQSTECFQSATDVAAFLGALASSGNLNVPYIEAVTSVQPSPASSELYPMY
VVFLGLAVLGFICLGVLVSRKRRREHGQLWFPEGFKVSEPSKKKRREPVGEDSVGLKPLK
NILDISLMDDSQNGLWGEEEPDSRRFRFEEQAVLDLDDRTDHRQWTQQHLDAADLRIPSI
APTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDPSAEIISDFIYQG
ANLHNQTDRTGETALHLAARYARSDAAKRLLESTADANVQDNMGRTPLHAAVAADAQGVF
QILIRNRATDLDARMHDGTTPLILAARLAVEGMVDELINCHADANAIDDFGKSALHWASA
VNNVDAAMVLLKNGANKDMQNNKEETPLFLAAREGSYETAKILLEHFANREITNHLDQLP
RDIAQERMHHDIIRLLDEYNLVRSPGLHNGTLSATNLSPPLCSPNGYLGSLKPTAPGKKV
RKPGSGGKDGGKDMRIRKKKSLDGKGMLLDSSAVLSPVDSLESPHGYLSDVASPPMTSPF
QQSPPMSFNHLQGSGDSHVGQMGMGKGQDMGRMPFDPNPPRLSHLPVSSPGSQGTITMAM
GGAGGRGQCDWHSRIHLGLGQQGGFNQGLPMSHGMMAPLRGVPTATLSRIMGYQGLQTSH
LGTPPHLMQQMHSRQNPQLQHQTSNSTTAGQVLGQSFLSSELSGSDLQQGNGVGRSVPIH
TILPQETQILGTQFLTPPSQHSYSGPIDNTPNHQLQVPDHPFLTPSPGSPDQWSSSSPHS
NMSDWSEGISSPPMSLHSQMGLIPNQFK
NT seq 7467 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtttctttgtgaaactaacgtttcttattccagtcatcgtcataacacaaggt
ctaagatgctctctaactactgaatcatgtctgaatggagggaggtgtgaggcctcctct
gacagaaatggagaatgcaggtgtacaagtgactatgtgggtagccgctgccagtactcc
aacccctgcaacccctcgccatgccgcaacgggggcgagtgccgcgccgtatcccacggc
aacacttttgagttccactgcaaatgtcgactgggcttctccgaccagctgtgcctgacg
cctaccaaccatgcctgcatgagttcgccatgtcgcaatggagggacttgtgacctgatc
acgctctccgactaccgctgccgctgcccgcccggatggtcagggaagacatgccagatt
gccaacccctgtgcatccaacccctgtgccaacggtggacaatgctcacccttcgagtcc
cactacatctgcgcatgcctgcccgccttccatggccagacctgcaagctggacgtcaat
gagtgtgcccagatgtcgtcaccctgtcgcaacgggggcatgtgtgtgaatgaggtgggc
tcctaccactgccgctgcccccaggagtacacgggtgccaactgcgagaccccctacatg
ccctgcaacccctctccctgccacagtgggggcacttgcgtgcagaagggggacaccagc
tatgactgcagctgcctgccaggatttacaagtcagaattgtgatcacaacattgatgac
tgcccaggccacaactgtcagaatggtggcttgtgtgtggatggggtcaacacctacaac
tgccagtgcccccctcactttacaggccagttctgtaccgagaatgtggatgagtgtgag
atgatgccaaacacgtgccagaacggcggtacgtgccacgacacctatggcagcttccac
tgtgtctgtgtcaatggctggacgggcgatgactgcagtgagaacatcgacgactgtgcc
agcgcagcctgttatcacggcgccacatgccacgaccgtgtagcgtccttcttctgcgag
tgtccacatgggcgcacaggtttactgtgtcatcttgatgatgcctgcatcagtaacccg
tgtcagaaaggctctaactgtgacaccaatcctgtcaacgggaaagccatctgtacctgc
cctccaggttacactggctctgcatgcaaccaggacattgacgagtgttccttaggtgcc
aacccttgcgagcacggtgggcgctgcctgaacactaaaggctcgttccagtgcaagtgt
ctccagggttatgagggcccgcggtgcgagatggatgtcaacgagtgcatgtccaacccc
tgtcagaacgatgccacatgcctggaccaaattggaggattccactgcatctgcatgcca
ggttatgagggggtgttttgccagatcaacactgacgagtgtgccagcatgccctgtctg
aacaacgggaagtgcatcgacaggatcaactccttccactgcgagtgccacaaaggcttc
tctggtggtctatgtcaggttgacatcgatgagtgtgccagcacgccctgcatgaacgga
gccaagtgtaccgacggccctaacaagtactcatgtgaatgcactgaaggttactctgga
cagcactgtgagactgacatcaacgagtgttactcggacccctgtcactatggcacgtgt
aaggacggcctggccaccttcacctgctactgtcaccctggttacacgggccgcctgtgt
gagaccaacatcaatgagtgtctgagccagccatgtcagaacggaggcacctgtcaggac
agggagaacacttacatctgcacctgccccaagggcactgcaggctttaactgtgaggtg
aatctggatgactgtaagagcaagccctgtgactacgggaggtgcattgacaagatcaac
agctatgagtgtgcatgtgagccaggttacgcaggcgccatgtgcaacatcaataccgat
gagtgtgccatcaacccctgtcacaatggtggcacctgcatcgatggcatcaacagcttc
acatgcctgtgcccagagggctacagtgatgccacctgtctgttgcaggtggacgagtgt
ggcagcaacccctgcatccatggtcgctgccaggatctgctcaatggctacaggtgtgtc
tgtgactctggctggggtgggcctaactgtgacatcaacaacaacgagtgtgagtccaac
ccgtgtatgaacggtggcacctgcaaggatatgaccagtggatatgtttgtagctgccga
gccggcttcagtggacctaactgccaaactaacatcaacgagtgtgcctccaacccctgc
ctgaaccagggcacctgcattgacgatgtggccggctacaagtgcaactgcttactgccc
tataccggtgagatgtgtgagacactgctggccccatgcagccccatgcagccctgtaag
aacagtggagtgtgtcatgagtcagaggactaccagagcttctcctgcctctgtccagag
ggatggcaaggtcaaacatgcgagatagatatcaacgaatgtgtgaaaagtccttgccgc
agcggcgccacatgccacaacatggtgggcagctaccgatgcagctgccgtccgggctac
accggccagaagtgtgagacggacatcgacgactgcaagcccaacccctgcagtaatgga
ggtctgtgcagagatggagtggacagctttgtgtgcacttgtctgccagggttccgtggt
ggcaggtgtgagcatgacattaatgagtgcgagagcaacccgtgtaagaatggggccaac
tgcacagactgtgtcaactcctacacctgcacctgtccacccggtttcagtggcatcaac
tgcgagaataacacccccgactgcacagagagctcttgcttcaacggtggcacctgcgtg
gatggcatcaataccttcacctgcctgtgtctgccaggcttcacaggcagctactgccag
cacgacatcaatgagtgtgactccaagccctgcctcaatggtggcacctgtctggacagc
tacggcacctacaagtgtacctgctctcatggctacactggagtcaactgccagaacctg
gtgcggtggtgtgactcatctccctgtaagaatggaggctcatgttggcagcagggctcc
tcgtacacctgtcagtgtcagacgggatggaccggcctctactgtgacgtccccagtgtc
tcctgcgaggtggctgccaaacagcaaggtgtggaggtgggtcacctgtgtcgtaactcg
ggccagtgtctggatgctggcaacacccactactgccgctgccaggcgggctacatgggc
agctactgccaggaacaggtggacgagtgctcccccaacccttgccagaacggtgccacc
tgcacagactacctgggagggtacagttgtgagtgtcttcctgggtaccacggggtgaac
tgctccaaggagatcaacgaatgtctgtctcagccctgtcagcacgggggcacctgcatc
gacctcataaacacctacaaatgctcctgtcccagaggaacacaaggcattcactgtgag
atcaacctggatgactgcaacccctctacagaccctctgaccaatgagcccaagtgtttc
aacaagggtcagtgtgtggacagagtggggggctaccactgcatgtgccccgctggctac
gtaggggagcgctgcgagggtgacgtcaacgagtgcctgtcggacccctgcgacctgcga
ggctcctacaactgtgtccagctcaccaacagctaccgctgcgagtgtcgcactggatac
acaggccagcgctgtgacaaagtgtttgatggctgtaaggggagaccatgtaggaacgga
ggaatgtgtgcagtggccagtaacaaccccgacggattcatctgcaaatgcccaccgggt
tacacaggctcctcctgcgaatacgactcacgcttctgtggtagcctcaactgcagaaat
ggtggcacctgtgtctctggccacctgagccctcgttgcttgtgccccacagcttttacc
ggccctgagtgccagactcccacgaacagcccctgcaatgtcaaccactgctacaacggg
ggcacttgccagagaacccccgatgcacccttcttccactgcagctgcccgaacaacttc
aatggcctgctctgccacatccttgattactcctttcccggtgggttcggccgggacatc
acaccaccacccgaggtagaggtaagctgcgagatcccgcagtgcgacgagtgggcgggc
aaccacatctgtgactcgctgtgcaacaaccacgcctgcggctgggacggtggcgactgc
tcgctcaacttcgatgacccatggcagaactgctcggcagctctgcagtgctggcggtac
ttcaatgacgggaagtgcgacgagcagtgcaaaagccctgggtgtctctacgacggcttc
gactgccagggacaggagggacagtgcaacccgctgtatgaccagtactgtaaggaccac
tacgcggacggccactgcgaccagggctgtaacaacgcagagtgcgagtgggacggcctg
gactgcgccaacaacatgcccgagaagctagctgacggccacctggtccttgtggtccac
atcccccccgagcagctaaaaaatggtttgtccacgttcctccgtgagctcagcagcgtt
ttgcacaccaacgtggtgttccggcgcgacgcaaacggagagcccatggtgttcccctac
tatggcagcgagcaggagctggccaagcacaacgtaaagcgttccaccgacagctggcct
gactgggcggtcgtgccggccaacatgctcggccaggtgaaggagagcgtggggtccatg
gtgaacctgccccgccagcgccgagaattggacctcatgcaggtcaaagggtcggtggta
tacctggagattgataaccgccagtgctaccagcagtccacggaatgcttccagagcgcc
accgacgtcgccgcgttcctgggagcgctggcctccagcgggaacctcaatgttccttac
atcgaggcagtcaccagtgtgcagcccagccctgcatcctctgagctatacccaatgtac
gtggtgttcctggggctggctgtactgggcttcatctgcctgggcgtgctggtgtcacgt
aaacgccgacgggagcacggacagctctggttccctgagggcttcaaagtttctgagccc
agcaagaagaaacgcagagagcccgtaggagaggactctgtgggactcaagccactgaag
aacattttggacatttctctgatggacgacagccagaatggattgtggggagaggaggag
ccagactctagacgctttaggtttgaggagcaggccgtgttggacctagatgaccgcact
gaccacagacagtggacccagcaacacctggacgcggctgacctgcggatcccttccatt
gcccccacgcctccccagggagagatcgagaatgactgcatggacgtcaatgtccgaggc
ccagatggtttcactcctctaatgatcgcatcgtgcagcggaggaggcttggagacgggg
aacagtgaggaggaggaggacccttcggctgagatcatctctgacttcatctaccagggc
gccaacctgcacaaccagacggaccgcacaggtgagaccgctcttcacctggccgcccgc
tacgcccgttccgacgccgcgaagcgactgctggagtccaccgccgacgccaatgtccag
gacaacatggggcgcactccactgcatgccgctgtcgcagcagacgcacagggagtcttc
cagattctgatccggaaccgggcaactgaccttgacgcccgcatgcatgatggaacaact
cctctgatcctggctgcccgattggctgtggaaggcatggtggatgagcttatcaactgc
catgctgatgccaacgccatcgatgactttggtaaatctgcccttcattgggcttcagct
gtcaacaacgtggatgctgccatggtgttgttgaagaatggcgccaacaaagacatgcag
aacaataaggaggaaactcctctctttctggcagccagagagggcagttatgagacggcc
aagatactgctggagcactttgccaaccgtgagatcaccaaccacctggaccagctgccc
cgggacatcgcccaggagcgaatgcaccatgacatcatccgtctgctcgatgaatacaac
ctggtgaggagcccagggctccataatgggaccctgagcgccactaacctgtctcctcct
ctgtgctcccccaacggatacctgggcagcctcaagcccaccgccccgggcaagaaggtc
cgcaagccaggctctggggggaaggatggtggcaaagatatgaggatacggaagaagaag
tccctggacgggaagggcatgctgctggacagctcagccgttctctcgcccgtcgactcc
ctggagtcgccccacgggtacctgtccgacgtggcgtcgccaccaatgacatcgccattc
cagcagtctccgcccatgtcgttcaaccacctgcaaggaagtggagacagccacgtgggt
cagatgggcatgggcaaggggcaggacatggggcgtatgccctttgacccgaaccctccc
cgcctgtcccacctgcctgtttccagccccggcagccagggaaccatcactatggccatg
ggcggagctgggggaagaggacagtgtgattggcactccaggatacacctgggtctcggg
cagcagggtggctttaaccaaggccttcccatgtcccatggtatgatggctcccctccgc
ggggtccccactgccaccctgtcccggatcatgggctaccagggcctgcagaccagccat
ctgggcacgccgccccacctcatgcagcagatgcactcccggcagaacccgcagctccag
caccagacctccaactccaccacggctggccaggtcctgggccagagtttcctgagcagc
gagctgagcggctcggacctgcagcagggcaacggggtgggtcgctcggtccccatccac
accatcctcccccaggagacccagattctcggcacacagttcctcaccccaccctcccag
cacagctattccggcccaatagacaacacacccaatcaccagctgcaggtgcctgaccac
ccctttctaactccctcccccggatcccctgaccaatggtccagctcctctccacattcc
aatatgtctgattggtcagagggcatctccagtcctccaatgagtttgcattctcagatg
ggacttatccctaaccagtttaagtag

DBGET integrated database retrieval system