KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219784
Entry
112219784         CDS       T05605                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112219784
   04012 ErbB signaling pathway
    112219784
   04310 Wnt signaling pathway
    112219784
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112219784
  09143 Cell growth and death
   04210 Apoptosis
    112219784
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219784
   04530 Tight junction
    112219784
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112219784
   04621 NOD-like receptor signaling pathway
    112219784
   04625 C-type lectin receptor signaling pathway
    112219784
  09152 Endocrine system
   04912 GnRH signaling pathway
    112219784
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112219784
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112219784
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112219784
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 Jnk-SapK_ap_N Seryl_tRNA_N ZapB
Other DBs
NCBI-GeneID: 112219784
NCBI-ProteinID: XP_024237062
LinkDB
Position
20
AA seq 357 aa
MMAKMDTPFYHDEAPGIPHNFGQHHADYQRYQGHKMMSKKVAHNFSGGSHSSSGLKLSQN
QPGSNCNINPSNLGGINSNTNSLLMPGGLSDMNLLKLASPDLEHLIIQSNQGLVTTSPVP
NPNGGNPFMYRNNATNEQEGFADGFVKALADLHKQNQLVGAPVSPSSSMQGPYQRNIMSA
GDLPIYTNLSSYNPNHPSHISSSYPGGQMPXXYPXHGPHXXGGQGPHHPHNRGLDAPQTV
PEXXHPXGDPTSSPPSLSPIDLETQERIKAERKKLRNRIAASKCRKRKLERISRLEEKVK
VLKTQNCDLTSTASVLREQVAQLKQKVMNHVTNGCQIAVSSATLQANSTRERDSTNC
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgatggctaaaatggatacccctttctaccacgacgaagccccaggtattcctcacaac
ttcggacaacaccatgcagattaccaacgttaccagggccacaagatgatgagtaagaag
gtggcacataacttctcaggcggttcccacagcagctctggcctgaaactgtcacaaaac
cagccggggagcaactgcaatatcaatcctagtaatctgggagggattaacagcaacaca
aacagcttgttaatgcccggcggcttgtcagatatgaaccttctgaagctagcctcccct
gacctcgagcacctcatcatccagtctaaccagggcctagtgacgacatctcctgtcccc
aaccctaacggaggtaaccccttcatgtaccggaacaacgccactaatgaacaggagggt
tttgccgatgggttcgtcaaagccctggcggatcttcataaacagaaccagctggttgga
gctcccgtgtccccttcctcctctatgcaaggcccctaccagaggaacatcatgtctgca
ggagacctgcccatctataccaacctcagcagctacaacccgaaccaccccagccatata
tcatcatcctacccagggggccagatgcccgrcrgctacccakgccayggcccccacrga
cyyggaggccagggaccccaccatccycacaacagggggttggacgcccctcagactgtc
ccagagrtmcstcaycctyccggggaccccacctcctcccctccctcgctctctcccatc
gacctggagacccaggagaggatcaaggcygagaggaagaaactacgtaaccggatcgcg
gcgtctaagtgtcgtaaaaggaagctggagcggatctccaggctagaggagaaggtgaag
gttctgaagacccagaactgtgacctgacctccaccgcctcggtcctgagggaacaggtg
gcccagctcaaacagaaagtcatgaatcacgtcaccaacggctgccagatagcagtgagt
tcagccaccctgcaggccaacagcaccagggagagggacagcaccaactgttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226753
Entry
112226753         CDS       T05605                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226753
   04012 ErbB signaling pathway
    112226753
   04310 Wnt signaling pathway
    112226753
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112226753
  09143 Cell growth and death
   04210 Apoptosis
    112226753
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226753
   04530 Tight junction
    112226753
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112226753
   04621 NOD-like receptor signaling pathway
    112226753
   04625 C-type lectin receptor signaling pathway
    112226753
  09152 Endocrine system
   04912 GnRH signaling pathway
    112226753
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112226753
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112226753
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112226753
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 NBP1 PspA_IM30 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 112226753
NCBI-ProteinID: XP_024247043
LinkDB
Position
28
AA seq 316 aa
MPTKMEATFYDESVNGQQGAVGGYHGFNPNSMKQSMTLNLNDPKMFKPHLRAKAIDILTS
PDVGLLKLASPELERLIIQSCNGLTTPTPTQFLCPKNITDEQEGFAEGFVRALAELHYQQ
HMPNGSCDSQTNASNDMASASTILDSPIPYSCTVRPEPPEYTNLGLFNRAVSSASAPTGD
RHSSASYTSVPSQTHIETQLPAQHPRLQPFKEEPQTVPEMSGDTPPMSPIDMESQERIKA
ERKRMRNRVAASKCRKRKLERISRLEDRVKNLKTQHTELVSSANVLRDELALLKQKVMDH
VNSGCQLILTQQLQAF
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcccaccaagatggaagctacattctatgacgaatcggtaaatggtcagcaaggcgca
gtgggtggatatcatgggtttaacccgaatagtatgaagcagagtatgacactgaacctc
aacgaccctaaaatgtttaaacctcatctgcgggcgaaagctatcgatatactgacgtcc
cctgatgtgggattattaaaactggcctctccggaattggaaaggctcatcatccagtcc
tgcaatggtttgacgactccgaccccaactcagttcctctgtcccaagaacatcaccgac
gagcaagagggttttgctgagggtttcgtgagggcgctcgcggagcttcattatcaacag
catatgcctaatgggagttgtgactctcagacgaatgcttcaaacgacatggcatccgca
tctactatattggacagtcctataccctacagctgcaccgtgcgccccgagccaccggaa
tacacaaacttgggccttttcaatcgggctgtcagctctgcgtcggcacctaccggcgac
agacactcttccgccagttacacgtccgtcccgtcccaaacccacatcgagacccagctg
ccagcccagcacccacggctacagccattcaaagaggagccccagacggtgcccgagatg
agcggcgatacccctccgatgtctcctatcgacatggagagccaggagaggataaaggcc
gagagaaagcgcatgaggaacagggtggccgcgtctaaatgccggaaaaggaagctggag
aggatctcgaggctggaggacagggtcaaaaacctgaagacgcaacacacagagttggtc
tcttctgccaacgtgctccgggacgaactggcactgctcaaacagaaggtcatggaccat
gttaacagcgggtgccaactcatattgacgcagcagctccaggcgttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248681
Entry
112248681         CDS       T05605                                 

Definition
(RefSeq) transcription factor AP-1-like isoform X1
  KO
K04448  transcription factor AP-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112248681
   04012 ErbB signaling pathway
    112248681
   04310 Wnt signaling pathway
    112248681
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112248681
  09143 Cell growth and death
   04210 Apoptosis
    112248681
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112248681
   04530 Tight junction
    112248681
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112248681
   04621 NOD-like receptor signaling pathway
    112248681
   04625 C-type lectin receptor signaling pathway
    112248681
  09152 Endocrine system
   04912 GnRH signaling pathway
    112248681
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112248681
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112248681
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112248681
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB FlaC_arch DUF3450 Jnk-SapK_ap_N TEX13
Other DBs
NCBI-GeneID: 112248681
NCBI-ProteinID: XP_024273684
LinkDB
Position
1
AA seq 324 aa
METTFYDDSLNSFSQHEKPDYGYNPKALKHSMTLNLADPTSTLKPHLRAKASDILTSPDV
QLLKLASPELERLIIQSSNGLITTTPTPTQFLCPRNVTDEQEGFAEGFVRALAELHHQHV
LPNAPGVPVTSAGQTSINNQTILPPVSALTGSSVYNNNMAMRSESPVYEDLNTFTPAITT
NSALGYTTSAPAMSFPSAPPQLPVYGQQSHPHPRLTALKEEPQTVPEMPGETPPLSPIDM
ENQERIKAERKRMRNRVAASKCRKRKLERISRLEDKVKNLKTQNSDLASTANMLREQVAQ
LKQKVMNHVNSGCQLMLTQQLQTF
NT seq 975 nt   +upstreamnt  +downstreamnt
atggaaactaccttctatgatgactcgctcaactctttctcccagcatgagaaaccggac
tacggatacaaccccaaagcactgaaacacagcatgacactgaacttggccgacccaacc
agcacactcaaacctcacctccgggctaaagccagtgacatcctcacctcccctgacgtg
cagctcctcaaactggcctccccagagttggagcggctcatcatccagtctagcaacggc
ctgatcaccaccacacctaccccgacgcagttcctctgcccaaggaacgtaaccgatgag
caagagggctttgccgagggatttgttagagcactggcggagctccatcatcaacacgtc
ttgcccaatgcacccggggtcccagtcacatccgctgggcagacaagtatcaacaaccaa
acaatactcccacctgtttccgccttgaccgggagcagtgtttataacaacaacatggcc
atgcgctctgagtcgcctgtctacgaagacctgaatacgttcaccccggctatcaccacc
aactcagccctgggttacaccacctcagccccagctatgagctttccctctgccccacca
cagctcccagtctatgggcagcagtctcacccccaccccaggctcactgccctgaaagag
gagccccagacggtgcctgagatgcctggggagaccccccctctctcccccatcgatatg
gagaatcaggagaggatcaaagccgagaggaagcgcatgaggaaccgcgtcgccgcctcc
aagtgcaggaagcggaagctggagcgcatctcccggctggaggacaaggtgaagaacctg
aagactcagaactccgacctggcttccacagcaaacatgctgagggaacaggtcgcccag
ctcaaacagaaggtgatgaaccatgtcaacagcggctgtcaactcatgcttacgcagcag
ctccagaccttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251077
Entry
112251077         CDS       T05605                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251077
   04012 ErbB signaling pathway
    112251077
   04310 Wnt signaling pathway
    112251077
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112251077
  09143 Cell growth and death
   04210 Apoptosis
    112251077
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251077
   04530 Tight junction
    112251077
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112251077
   04621 NOD-like receptor signaling pathway
    112251077
   04625 C-type lectin receptor signaling pathway
    112251077
  09152 Endocrine system
   04912 GnRH signaling pathway
    112251077
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112251077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112251077
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112251077
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB FlaC_arch DUF3450 Jnk-SapK_ap_N Paralemmin TEX13
Other DBs
NCBI-GeneID: 112251077
NCBI-ProteinID: XP_024277524
LinkDB
Position
5
AA seq 327 aa
MSTKMETTFYDDSHNAFSQHQNAGYGYNPKALKHSMTLNLADPTITLKPHLQAKASDILT
SPDVQLLKLASPELERLIIQSSNGLITTTPTPTQFLCPRNVTDEQEGFAEGFVRALAELH
HQHVLPNAPGVPVTSTGQTRINNSTTLPPVCSVAGSTVYNNVAMRSESPVYENLNTFTPA
VTTNSAPGYTTSVPAMSFPSAPPQLPIYGQQSHPHPRLTALKEEPQTVPEMLGETPPLSP
IDMENQERIKAERKRMRNRVAASKCRKRKLERISRLEDKVKNLKTQNSDLASTANMLREQ
VAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtctaccaagatggaaactactttctacgacgactcgcataacgctttctcccagcat
cagaacgcgggctacggatacaaccccaaagctctgaaacacagcatgacactgaacctg
gctgacccaaccatcacactcaaacctcacctccaggctaaagccagcgatatcctcacc
tctccggatgtgcagctcctcaaacttgcctccccagagttggagcgactcatcattcag
tccagcaacggcctgatcaccaccacacctaccccgacgcagttcctctgtccgaggaac
gtgactgatgagcaggagggctttgccgaggggttcgttagagctctggcggagctccat
catcaacacgtcttgcccaacgcacctggggtcccagtcacctccaccgggcagacacga
atcaacaactcgaccacactcccacctgtttgctccgtggctgggagcactgtttataac
aacgtagccatgcgctctgagtcacctgtctacgaaaacttgaacactttcaccccggct
gtcaccaccaactcagccccgggttacaccacctcagtgccggctatgagcttcccctct
gccccgcctcagctccccatctatgggcagcagtctcacccccaccccaggctcacagcc
ctgaaagaggagccccagacggtacctgagatgctcggggagacccctccactctctccc
atcgacatggagaatcaggagaggatcaaagccgagaggaagcgcatgaggaaccgcgtc
gccgcttccaagtgcaggaagcggaagctagagcgcatctcccggttggaggacaaggtg
aagaacctgaagactcagaactccgacctggcttccacagccaacatgctgagggaacag
gtagcccagctcaaacagaaggtgatgaaccacgttaacagcggctgtcaactcatgctg
acgcagcagctccagaccttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257314
Entry
112257314         CDS       T05605                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112257314
   04012 ErbB signaling pathway
    112257314
   04310 Wnt signaling pathway
    112257314
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112257314
  09143 Cell growth and death
   04210 Apoptosis
    112257314
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257314
   04530 Tight junction
    112257314
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112257314
   04621 NOD-like receptor signaling pathway
    112257314
   04625 C-type lectin receptor signaling pathway
    112257314
  09152 Endocrine system
   04912 GnRH signaling pathway
    112257314
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112257314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112257314
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112257314
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 Jnk-SapK_ap_N Seryl_tRNA_N ZapB
Other DBs
NCBI-GeneID: 112257314
NCBI-ProteinID: XP_024286575
LinkDB
Position
9
AA seq 357 aa
MTAKMETPFYHDESLGVPHNFGQHHADYQRYQSHKMMSKKVAHNFSGGSHSSSGLKLSQS
QPGSNCNINPSNLGGINSNTNSSLMPGGLSDMNLLKLASPDLEHLIIQSNQGLVTTSPVP
NPNGGNPFMYRNNATNEQEGFADGFVKALADLHKQNQLVGAPVSPSSSMQGPYQRNIMSA
GDLPIYTNLSSYNPNHPSHISSSYPGGQMPXXYPXHGPHXXGGQGPHHPHNRGLDAPQTV
PEXXHPXGDPTSSPPSLSPIDLETQERIKAERKKLRNRIAASKCRKRKLERISRLEEKVK
VLKTQNCDLTSTASVLREQVAQLKQKVMNHVTNGCQIAVSSAGLQSKSTGERESTSC
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgacggctaaaatggaaactcctttctaccacgacgagtccctaggtgttcctcacaac
ttcggacaacaccatgccgattaccaacgttaccagagccacaagatgatgagtaagaag
gtggcacataacttctcaggcggttcccacagcagctctggcctgaaactgtcacaaagc
cagcccgggagtaactgcaatatcaatcctagtaatctgggagggattaacagcaacaca
aacagctcgttaatgcccggcggcttgtcagatatgaaccttctgaagctagcctcccct
gacctcgagcacctcatcatccagtctaaccagggcctagtgacgacatctcctgtcccc
aaccctaacggaggtaaccccttcatgtaccggaacaacgccactaatgaacaggagggt
tttgccgatgggttcgtcaaagccctggcggatcttcataaacagaaccagctggttgga
gctcccgtgtccccttcctcctctatgcaaggcccctaccagaggaacatcatgtctgca
ggagacctgcccatctataccaacctcagcagctacaacccgaaccaccccagccatata
tcatcatcctacccagggggccagatgcccgrcrgctacccakgccayggcccccacrga
cyyggaggccagggaccccaccatccycacaacagggggttggacgcccctcagactgtc
ccagagrtmcstcaycctyccggggaccccacctcctcccctccctcgctctctcccatc
gacctggagacccaggagaggatcaaggcygagaggaagaaactacgtaaccggatcgcg
gcgtctaagtgtcgtaaaaggaagctggagcggatctccaggctagaggagaaggtgaag
gttctgaagacccagaactgtgacctgacctccaccgcctcggtactgagggaacaggtg
gcccagctcaaacagaaagtcatgaatcacgtcaccaacggctgccaaattgcagtcagc
tcagcaggcctgcagtccaagagcaccggggagagggagagcaccagctgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260691
Entry
112260691         CDS       T05605                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260691
   04012 ErbB signaling pathway
    112260691
   04310 Wnt signaling pathway
    112260691
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112260691
  09143 Cell growth and death
   04210 Apoptosis
    112260691
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260691
   04530 Tight junction
    112260691
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112260691
   04621 NOD-like receptor signaling pathway
    112260691
   04625 C-type lectin receptor signaling pathway
    112260691
  09152 Endocrine system
   04912 GnRH signaling pathway
    112260691
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112260691
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112260691
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112260691
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 NBP1 PspA_IM30 Takusan Phlebovirus_NSM Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 112260691
NCBI-ProteinID: XP_024291754
LinkDB
Position
10
AA seq 321 aa
MPTKMEATLYDESINGQQGAVGGYHGFNPKTLKQSMTLNLNDPKMFKPHLRAKAIDILTS
PDVGLLKLASPELERLIIQSCNGLTTPTPTQFLCPKNITDEQEGFAEGFVKALAELHYQQ
HMPNGSSDAQANAANNMAPSSTVSDSPIPYSCTVRPDPPEYTNLGTFSRAVSSASALNGD
RHSSASYTAVPSQIHVEPQRPPQHPRLQHARLQSFKEEPQTVPEMSGDTPPLSPIDMESQ
ERIKAERKRLRNRVAASKCRKRKLERISRLEDRVKNLKTQHTELVSSANVLRDELALLKQ
KVMDHVNSGCQLILTQQLQAF
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcccaccaagatggaagctacattatatgacgaatctataaatggtcagcaaggcgca
gtgggcggatatcatgggtttaacccgaaaaccctgaagcagagcatgacactgaacctc
aacgaccctaaaatgtttaaacctcatctgcgggcgaaagctatcgacatcctgacatcc
cctgatgtgggattattaaaactggcttcccctgaattggaaaggcttatcatccagtcc
tgcaatgggctgacgactccgaccccaactcagttcctctgtcccaagaacatcaccgac
gagcaagagggttttgcggagggattcgtaaaggcgctcgcggagcttcattatcaacag
catatgcccaatggcagctctgacgctcaagccaatgctgccaacaacatggcaccctca
tctactgtgtcggacagtcctataccctacagctgcaccgtgcgccccgacccacctgaa
tacacaaacttgggcactttcagtcgggctgtcagctctgcgtcggcacttaacggcgac
cgacactcctccgctagttacacggccgtcccgtcccaaatccacgtcgagccccagcgg
ccaccccagcatccacggctacagcatgctcggctacagtcattcaaagaggagccccag
acggtgcccgagatgagcggcgatacccctccgctgtctcctatcgacatggagagccag
gagcggataaaagccgagagaaagcgcttgagaaacagggtggccgcgtccaaatgccgg
aaaaggaagctggagaggatctcgaggctggaggacagggtcaaaaacttgaagacccaa
cacacagagctggtctcctctgccaacgtgctccgggacgaactggcactgctcaaacag
aaggtcatggaccacgttaacagcgggtgccaactcatattgacgcagcagctccaggcg
ttctga

DBGET integrated database retrieval system