KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219828
Entry
112219828         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112219828
   04068 FoxO signaling pathway
    112219828
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112219828
   04210 Apoptosis
    112219828
   04115 p53 signaling pathway
    112219828
   04218 Cellular senescence
    112219828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112219828
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112219828
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112219828
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112219828
NCBI-ProteinID: XP_024237100
LinkDB
Position
20
AA seq 154 aa
MTLEEVLIQKFAERAQCTGNALEEVLLSAKENDCLTVGVYESAKVMNVDPDSVSFCVLAT
DEEWECDIALQIHFTLIQSFCFDNDISIVRVNDMQRLAEIVGDKTGQLEDAHCCLITNPA
DGSWEDAALEKLHLFCEESHSLNDWVPEITLLER
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactcttgaggaagttctgatccagaagttcgctgagcgtgcccagtgcaccggcaat
gcactagaggaagttttgctctctgctaaagaaaatgactgcctgacggttggtgtctac
gagtctgctaaagttatgaatgttgacccagacagcgtgtctttctgcgttctggccacc
gatgaggagtgggagtgtgacattgctctccagatccacttcaccctcatccagtctttc
tgttttgacaacgacatcagcatcgtcagagtgaacgacatgcagcgcctggccgaaatt
gttggggacaagactggccagcttgaagatgcccactgctgtcttatcactaacccagct
gatggttcttgggaggacgctgctctggagaagctgcacctgttctgtgaggagagccac
agtctgaacgactgggttccagagatcacccttcttgagcgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219829
Entry
112219829         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112219829
   04068 FoxO signaling pathway
    112219829
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112219829
   04210 Apoptosis
    112219829
   04115 p53 signaling pathway
    112219829
   04218 Cellular senescence
    112219829
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112219829
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112219829
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112219829
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112219829
NCBI-ProteinID: XP_024237101
LinkDB
Position
20
AA seq 140 aa
MEAIGKSLKEALKSAQCEDRLTVGVYESAKIMNDDPDSVSLCVLATDEEWECEIALQIHF
TLIQSFCFDNDISIVRVNDMQRLAEIVGDKTGQLEDAHCCLITNPADGSWEDAALEKLHL
FCEESHSLNDWVPEITLLER
NT seq 423 nt   +upstreamnt  +downstreamnt
atggaagctattggcaaatctctgaaggaagctctcaagtctgcccagtgtgaggatcgc
ctcactgttggtgtatatgagagtgccaaaataatgaatgatgacccagacagcgtgtct
ctctgtgttctggccaccgatgaggagtgggagtgtgaaattgctctccagatccacttc
accctcatccagtctttctgttttgacaacgacatcagcatcgtcagagtgaacgacatg
cagcgcctggccgagattgttggggacaagactggccagcttgaagatgcccactgctgt
cttatcactaacccagctgatggttcttgggaggacgctgctctggagaagctgcacctg
ttctgtgaggagagccacagtctgaacgactgggttccagagatcacccttcttgagcgc
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227088
Entry
112227088         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112227088
   04068 FoxO signaling pathway
    112227088
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112227088
   04210 Apoptosis
    112227088
   04115 p53 signaling pathway
    112227088
   04218 Cellular senescence
    112227088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112227088
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112227088
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112227088
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112227088
NCBI-ProteinID: XP_024247693
LinkDB
Position
28
AA seq 160 aa
MCKMTFEELSGEYSTERMDTVTKALEEVLSSALPQGCITVGVYEAAKSLNVDPDNVVLCI
LATDDEDVKDVALQIHFTLIQAFCCENDINILRVNNTRRLAEILGGGGKQGGEPMDLHCV
LVTSPHSSSWKDPALSKVNRFCRESRCMDQWVPIINLPER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgcaagatgacatttgaggaactaagtggggaatattctacagaaaggatggataca
gtgacaaaagccttggaagaggttctctcatcagcattaccccaaggatgcataacagta
ggggtctatgaagcagctaaatcattgaatgtagatccagataatgtggttctgtgcatc
ctggctacagatgacgaggatgtaaaggacgtggcccttcagatccacttcaccctgatc
caggcattctgctgtgagaatgacatcaacatcctgcgagtgaacaacaccaggcgtctg
gcagagatccttggagggggagggaaacaagggggagagcccatggacctgcactgtgtc
ctggtcactagcccacactcctcgtcctggaaagacccagccctgagcaaagtgaaccgc
ttctgcagggagagccgctgcatggaccagtgggtgcccatcatcaacctccctgagcgc
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230512
Entry
112230512         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230512
   04068 FoxO signaling pathway
    112230512
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112230512
   04210 Apoptosis
    112230512
   04115 p53 signaling pathway
    112230512
   04218 Cellular senescence
    112230512
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112230512
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112230512
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112230512
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112230512
NCBI-ProteinID: XP_024252565
LinkDB
Position
33
AA seq 140 aa
METIGKSLKEALKSAQCEDRLTVGVYESAKIMNDDPDSVSFCVLATDEEWECNIALQIHF
TLIQSYCFDNDISIVRVNNMQRLAEIVGDKAGQLEDAHCCLITNSADGSWEDPALEKLHL
FCEESRGLNDWVPEITIPKR
NT seq 423 nt   +upstreamnt  +downstreamnt
atggaaacgattggcaaatctctgaaggaagctctcaagtctgcccagtgtgaggatcgc
ctcactgttggtgtctatgaaagtgccaaaataatgaatgatgacccagacagtgtgtct
ttctgtgtcctggcaaccgatgaggagtgggagtgtaatattgctctccagatccacttc
accctcatccagtcttactgttttgacaatgacatcagcattgtcagagtgaacaacatg
cagcgactggccgagattgttggggacaaggctggccagcttgaagatgcccactgctgt
ctcatcacgaactcagctgatggttcctgggaggaccctgctttggagaagctgcacctg
ttctgtgaggagagccgcggtctgaacgactgggttccagagatcaccatccctaaacgc
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230565
Entry
112230565         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230565
   04068 FoxO signaling pathway
    112230565
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112230565
   04210 Apoptosis
    112230565
   04115 p53 signaling pathway
    112230565
   04218 Cellular senescence
    112230565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112230565
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112230565
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112230565
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112230565
NCBI-ProteinID: XP_024252611
LinkDB
Position
33
AA seq 154 aa
MTLEEVLIQKPVERAQCTGKALEEVLLSAKDNNCLTVGVYESAKVMNVDPDNVCFCVLAT
DEEWECDIALQIHFTLIQSYCFDNDISIVRVNNMQRLAEIVRDKTGQLEDAHCCLIMNSA
DGSWEDPALEKLHLFCEESRGLNDWVPEITLPKR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactcttgaggaagttctgatccagaagcccgttgaacgtgcccagtgcaccggcaaa
gcgctggaggaagttctgctctccgctaaagacaacaactgcctgactgtcggtgtctat
gagtctgctaaagttatgaatgttgacccagacaatgtgtgtttctgtgtcctggcaacc
gatgaggagtgggagtgtgacattgctctccagatccacttcaccctcatccagtcttac
tgttttgacaacgacatcagcatcgtcagggtgaacaacatgcagcgactggccgaaatt
gttcgtgacaagactggccagcttgaagatgcccactgctgtcttatcatgaactcagct
gatggttcctgggaggaccctgctttggagaagctgcacctgttctgtgaggagagccgc
ggtctgaacgactgggttccagagatcaccctccctaaacgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248817
Entry
112248817         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112248817
   04068 FoxO signaling pathway
    112248817
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112248817
   04210 Apoptosis
    112248817
   04115 p53 signaling pathway
    112248817
   04218 Cellular senescence
    112248817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112248817
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112248817
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112248817
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112248817
NCBI-ProteinID: XP_024273914
LinkDB
Position
4
AA seq 161 aa
MTLELEEIRGQESALDTTDRLQIAGTALEELLVSAKKQDYLTVGVYESAKVMNVDADNVA
FCVLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGTDETGEPKDAHC
ILVTSPGAESWKDPALDKLHLFCEESRSVYDWVPTITLPER
NT seq 486 nt   +upstreamnt  +downstreamnt
atgactctggaactggaagagatccgtggacaggagagcgcactcgataccaccgataga
ctgcaaattgcaggcacagccctggaggagctgttggtgtctgcaaagaagcaggactat
cttacggtgggagtctacgagtctgccaaagttatgaatgttgacgcagacaatgtggca
ttctgcgttctggcgacagacgaggagtacgaatgcgacatcgcgctccagatccacttc
accctcatccaggctttctgcttcgataacgacatcaacgtggtgcgcgtaaacgatatc
gagcgcctggctgacctcgtgggcacggacgaaactggggaacccaaggacgcacattgc
attcttgtcacgagccccggtgctgagtcgtggaaagaccctgctttggacaaactgcat
ctgttctgtgaggagagccgcagtgtgtatgactgggttcccaccatcaccctccctgaa
cgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249878
Entry
112249878         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112249878
   04068 FoxO signaling pathway
    112249878
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112249878
   04210 Apoptosis
    112249878
   04115 p53 signaling pathway
    112249878
   04218 Cellular senescence
    112249878
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112249878
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112249878
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112249878
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112249878
NCBI-ProteinID: XP_024275358
LinkDB
Position
1
AA seq 157 aa
MCNMTFEETSGENSIERMDSVSKALEEVITSALPQGCVTVGVYEAAKSLNVDPDNVVLCL
LATDEEQVVDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGEEPMDLHCVL
VTKSSTCKDPALSKVNRFCRDSRILDQWVPIINLPDR
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtgcaatatgacttttgaggaaaccagtggagaaaactctatagaaaggatggattcg
gtgtctaaagcattggaggaggttatcacctccgcgttaccccaaggttgcgtcactgta
ggagtctacgaggcagcaaagtcactcaatgtggacccggataatgtggtactgtgcctc
ctggccacagatgaggagcaggtcgtggacgtggctttacagatccacttcaccctgatt
caggctttctgctgcgagaacgacatcaacatcctgcgggtcagcaacatgaggcgcctc
gctgagatacttggaggagtgaagcctggagaagagcccatggacctgcactgtgtacta
gttactaagtcaagcacgtgcaaggacccagctctgagcaaagtgaatcgcttctgtaga
gacagtcgaatactggaccagtgggtccccatcatcaacttacctgaccgatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250716
Entry
112250716         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112250716
   04068 FoxO signaling pathway
    112250716
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112250716
   04210 Apoptosis
    112250716
   04115 p53 signaling pathway
    112250716
   04218 Cellular senescence
    112250716
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112250716
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112250716
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112250716
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112250716
NCBI-ProteinID: XP_024276857
LinkDB
Position
5
AA seq 158 aa
MTLEELVGCNITEKKMETVNQALEELLVAAQQQDCLTVGVYESAKLMNVDPDSVVLCVLA
TDEDVIPLQIHFTLIQAFCCDNDINILRVSGMRRLAQVLGEPSTADSNGNEPNDLHCILV
TNTQCQSLKCQALQDVGNYCEESRCKNQWVPYLSLQER
NT seq 477 nt   +upstreamnt  +downstreamnt
atgactctggaggaactcgttggatgcaatatcactgagaaaaagatggagaccgtgaat
caagcactagaagagctgctggtggcagcgcagcaacaagactgcctgactgtgggagtc
tacgagtctgcaaagctgatgaatgttgatcctgacagtgttgtgttgtgtgttctggcg
actgacgaggatgtcattccactgcagattcacttcacgctcatccaagccttctgttgc
gacaacgacatcaacatactgcgtgtctccggcatgaggcgcctcgctcaggttcttggc
gagccaagcaccgctgacagcaacggcaacgagcccaatgatctgcactgcatccttgtc
actaacacccagtgccaatctctgaaatgccaagcgttgcaggatgtcggcaactactgc
gaggagagtcgctgcaagaaccaatgggtaccttacctgtccctgcaggagcgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251192
Entry
112251192         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251192
   04068 FoxO signaling pathway
    112251192
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112251192
   04210 Apoptosis
    112251192
   04115 p53 signaling pathway
    112251192
   04218 Cellular senescence
    112251192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112251192
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112251192
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112251192
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112251192
NCBI-ProteinID: XP_024277790
LinkDB
Position
5
AA seq 158 aa
MCNMTFEETSGENSTERMDSVAKALEEVLSSALPQGCITVGVYEAAKSLNVDPDNVVLCL
LATDEEQVEDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGGEPMDMHCVL
VTNPQLTTWKDPALSKVNLFCRDSRILDQWVPIINLPD
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtgcaatatgacttttgaggaaaccagcggagaaaactctacagaaaggatggattcg
gtggctaaagcactggaggaggttctcagctccgcgttacctcagggttgcattactgtc
ggggtatacgaggcagccaagtcactcaatgttgacccggataatgtggtgttgtgcctc
ctggcaacggacgaggaacaggtagaagacgtggccctccagatccactttacccttatc
caggcgttctgctgcgagaacgacatcaacatcctgcgggtcagcaacatgaggcgcctc
gctgagatccttggaggagtgaagccaggaggagagccaatggacatgcactgtgtacta
gttactaacccccagttgaccacatggaaggacccagctctgagcaaagtgaatctcttc
tgtagagacagtcgaatcctggaccagtgggtccccattatcaacctacctgactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251264
Entry
112251264         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251264
   04068 FoxO signaling pathway
    112251264
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112251264
   04210 Apoptosis
    112251264
   04115 p53 signaling pathway
    112251264
   04218 Cellular senescence
    112251264
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112251264
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112251264
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112251264
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112251264
NCBI-ProteinID: XP_024277935
LinkDB
Position
5
AA seq 158 aa
MCNMTFEETSGENSTERMDSVAKALEEVLSSALPQGCITVGVYEAAKSLNVDPDNVVLCL
LATDEEQVEDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGGEPMDMHCVL
VTNPQLTTWKDPALSKVNLFCRDSRILDQWVPIINLPD
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtgcaatatgacttttgaggaaaccagcggagaaaactctacagaaaggatggattcg
gtggctaaagcactggaggaggttctcagctccgcgttacctcagggttgcattactgtc
ggggtatacgaggcagccaagtcactcaatgttgacccggataatgtggtgttgtgcctc
ctggcaacggacgaggaacaggtagaagacgtggccctccagatccactttacccttatc
caggcgttctgctgcgagaacgacatcaacatcctgcgggtcagcaacatgaggcgcctc
gctgagatccttggaggagtgaagccaggaggagagccaatggacatgcactgtgtacta
gttactaacccccagttgaccacatggaaggacccagctctgagcaaagtgaatctcttc
tgtagagacagtcgaatcctggaccagtgggtccccattatcaacctacctgactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252104
Entry
112252104         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252104
   04068 FoxO signaling pathway
    112252104
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112252104
   04210 Apoptosis
    112252104
   04115 p53 signaling pathway
    112252104
   04218 Cellular senescence
    112252104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112252104
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112252104
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112252104
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112252104
NCBI-ProteinID: XP_024278823
LinkDB
Position
6
AA seq 160 aa
MTLEELGCNITEKKMETVSQALEELLVAAQQQDCLTLGVYESAKLMNVDPDSVVLCVLAT
DEEDEDDIALQIHFTLIQAFCCDNDINILRVSGIRRLAQVLGEPSTVDSNGNEPKDLHCI
LVTNTQCQSLKCQALQDVGNYCEESRCKNQWVPYLALQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactctggaagaactgggatgcaatatcactgagaaaaagatggagaccgtgagtcaa
gcactagaagagctgctggtggcagcgcagcaacaagactgcctgactttgggagtctac
gagtctgcaaaactgatgaatgtagatcctgatagtgtagtcttgtgtgttctggcgacg
gatgaggaagacgaggatgacatcgcactgcagattcacttcacgctcatccaagccttc
tgctgcgacaacgacatcaacatactgagagtctcgggcatcaggcgcctcgctcaggtt
cttggcgagccaagcaccgttgacagcaacggcaacgagcccaaagatctgcactgcatc
cttgtcactaacacccagtgccaatctctgaaatgccaagcgttacaggacgtgggcaac
tactgcgaggagagccgctgcaagaaccagtgggtgccttatctggccctgcaggagcgc
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260284
Entry
112260284         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260284
   04068 FoxO signaling pathway
    112260284
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112260284
   04210 Apoptosis
    112260284
   04115 p53 signaling pathway
    112260284
   04218 Cellular senescence
    112260284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112260284
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112260284
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112260284
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112260284
NCBI-ProteinID: XP_024291038
LinkDB
Position
10
AA seq 159 aa
MCKMTFEELSGDYSAERMDTVAKALEEVLSLALPQGCITVGVYEAAKSLNVDPDNVVLCI
LATDDEDVKDVALQIHFTLIQAFCCENDISILRVNNTRRLAEILGGGTQGGEPMDLHCVL
VTSPHSSSWKDPALSKVNRFCRESRCMDQWVPIINLPER
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtgcaaaatgacatttgaggaactaagtggggattattctgcagaaaggatggataca
gtggcaaaagcattggaagaggttctctcattggcattaccccaaggatgcattacagta
ggggtctatgaagcagcaaaatcattgaatgtagatccagataatgtggttctgtgcatc
ctggcaacagatgacgaggatgtaaaggacgtggcccttcagatccacttcaccctgatc
caggcattctgctgtgagaatgacatcagcatcctgcgagttaacaacaccaggcgtctg
gcagagatcctcggcggagggacacaggggggagagcccatggatctgcactgtgtcctg
gtcactagcccacactcctcctcctggaaagacccagccctgagcaaagtgaaccgcttc
tgcagggagagccggtgcatggaccagtgggtacccatcattaacctccctgagcgatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263967
Entry
112263967         CDS       T05605                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112263967
   04068 FoxO signaling pathway
    112263967
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112263967
   04210 Apoptosis
    112263967
   04115 p53 signaling pathway
    112263967
   04218 Cellular senescence
    112263967
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112263967
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112263967
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112263967
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112263967
NCBI-ProteinID: XP_024296357
LinkDB
Position
12
AA seq 161 aa
MTLELEEIFGQESALDATDRVQSAGTALEELLVSAKKQDYLTVGVYESAKIMNVDPDNVA
FCVLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLAELVGTEEAGEPKDAHC
ILVTSPGAESWKDPALDKLHLFCEESRSVYDWVPTITLPER
NT seq 486 nt   +upstreamnt  +downstreamnt
atgacactggaactagaagagatctttggacaggagagcgcactcgacgccacagataga
gtgcaaagtgcaggcacagccctggaggagttgttggtgtctgcaaagaagcaggactac
cttaccgttggagtctatgagtctgccaaaattatgaatgttgatccagacaatgtggca
ttctgcgttctggcgacagacgaggagtacgaatgcgacatcgctctccagatccacttc
accctcatccaggctttctgcttcgataacgacataaacgtggtacgcgttaacgatatc
gagcgcctggctgaactcgtgggcacagaagaggccggcgaacccaaggacgcacattgc
attcttgtcacgagccctggtgctgagtcatggaaagaccctgctctggacaaactgcat
ctcttttgtgaggagagccgcagtgtgtatgactgggttcccaccatcactctccctgaa
cgctga

DBGET integrated database retrieval system