KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220000
Entry
112220000         CDS       T05605                                 

Gene name
plk2
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220000 (plk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112220000 (plk2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112220000 (plk2)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112220000 (plk2)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112220000 (plk2)
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112220000 (plk2)
   Centrosome duplication proteins
    Regulators of centriole replication
     112220000 (plk2)
  Sister chromatid separation proteins
   Polo kinases
    112220000 (plk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Pkinase_fungal Kinase-like PhoD_N
Other DBs
NCBI-GeneID: 112220000
NCBI-ProteinID: XP_024237298
LinkDB
Position
20
AA seq 660 aa
MDILRSIAHQPTMCEHSVNKPSEIKRKKSEEQIQATQELSRIITDPTKGKCYCRGKVLGK
GGFAKCYEFTDLASGKVYAAKIIPHTRVSKPHQREKIDREIELHRILHHKHIVHFYHHFE
DKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQIVSGLRYLHEQEILHRDLKLGN
FFINESMDLKVGDFGLAAKLEPVENRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVM
YTMLLGRPPFETTNLKETYRCIREARYTLPSSLTAQAKQLISRMLAKSPADRPHLEDILR
HDFFTQGFTPDKLSASCCHTAPDLHHTSPAKSFFKKAAAALFGGGKKDKAKYLGTLNRMA
KEEEELTRLRNDLRKTSISQPLPRQASENSIKPPVAPTMARPAASVKEGVNGTNKQQLRD
TIRLIVRGTLGSCSSECLEDSTMGSVADTVARVLKGCLENMPEADDLPKENLGSSFQWVT
KWVDYSNKYGFGYQLSDHTVGVLFNNGTHMSLLADKRTVHYYAELGHCSVFSTCEAPEPF
IGQVTILKYFAHYMEENLMDGGDLPNVTDPRAPRLYLLQWLKSDRALMMLFNDGSFQVNF
YHDHTKILLCRQSDEYLLTYINEERISTNMRLSTLLMAGCSADLCSRMEYALNMLLQRCN
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggatatactcaggagtatcgctcaccaacccaccatgtgtgaacactccgtgaacaag
ccctccgagatcaagaggaagaagtcagaggagcaaattcaagccacacaagagttgtca
cggattattacggatccaacgaaggggaaatgctattgccgaggaaaagttctgggcaag
ggaggatttgccaaatgttatgaattcacagatttggcatcaggcaaagtgtatgctgca
aagatcattccacacacgcgggtctccaaaccgcaccaaagggaaaagattgacagagag
attgagctgcacagaattctccaccataagcacattgtgcacttctaccaccactttgag
gacaaagacaacatctacattctcttggaatactgcagtcgacgatcactggcccacatc
ctgaaggctcggaaagtattgacagagcctgaggtgaggtactacctccgacagatcgtc
tccgggttgaggtacctccacgaacaggagatcctgcacagggacctgaaactgggcaat
ttcttcatcaacgagtctatggacctgaaggtaggggactttggcctggctgccaagctg
gagcctgttgagaaccgaaggaggacgatatgtggcacgcccaactacctgtctcctgag
gtgctcaacaagcagggccacggctgcgagtcggacatctgggccctgggatgcgtcatg
tacaccatgctccttggcagacccccgtttgagaccaccaacctgaaggagacttaccga
tgtatccgtgaggcacgctacacgctgccctcctccctgacggcccaggccaaacagctg
atcagcaggatgctggccaagagccctgcagacagaccacacctggaggacatcctcaga
catgacttcttcacccaggggttcactccagacaagctgtcggccagctgctgccacacg
gccccagacctccaccacaccagccctgccaagagcttcttcaagaaggctgcggccgcc
ctgtttggagggggcaagaaggacaaagccaagtacttggggactttgaatagaatggcc
aaagaggaagaggagctcaccaggctgcggaatgacctgaggaagacgtctatcagccag
cctctccccagacaggcatcggagaacagcatcaagccccctgtggcccccaccatggcc
aggccagcggcctctgtcaaggaaggggtcaacggcaccaacaagcagcagctgagggac
acaatccgtttgattgtcagaggcaccctgggcagctgcagtagtgaatgtcttgaggac
agtaccatgggcagtgtagcagacactgtggcccgggtgctgaaagggtgtctggagaat
atgccggaagcggatgaccttcccaaagagaatctgggcagcagcttccagtgggtgacc
aaatgggtggactactccaacaagtatggctttggctaccagctgtcggaccacaccgtg
ggagtcctcttcaacaatggcacacacatgagtctgctggcagataagaggaccgttcac
tactatgccgagctgggccattgttctgtcttctccacctgcgaggctccagagccattc
ataggccaggtcaccattttgaaatactttgcccattacatggaggagaaccttatggat
ggtggagacttgcccaatgtgacagaccccagggcccccaggctctacctgctgcagtgg
ctgaagtccgaccgggccctcatgatgctcttcaacgacggctccttccaggttaacttc
taccatgaccacaccaagatcctcctgtgcagacagagtgatgagtacctgctcacctac
atcaacgaggagcgcatctccaccaacatgcgcctgagcaccctcctaatggccggctgc
agcgctgacctgtgcagtcgcatggagtacgcactcaacatgctgctgcagaggtgcaac
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226947
Entry
112226947         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK3-like
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112226947
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112226947
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226947
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112226947
   03400 DNA repair and recombination proteins [BR:otw03400]
    112226947
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112226947
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112226947
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    112226947
DNA repair and recombination proteins [BR:otw03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112226947
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 112226947
NCBI-ProteinID: XP_024247406
LinkDB
Position
28
AA seq 663 aa
MNTACFTTSQRTSCLTMNPDLFKPCPEHGQVIIPTKPNKTKSEQIKPDLAQVVTDSKTGK
SYSKGKLLGKGGFARCYEMTDLSSNKMYAVKVIPQSRVSKPHQRDKITNEIELHKTLHHK
HVVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEVRYYLRQIISGLKYLHNRG
ILHRDLKLGNFFVNENMELRLGDFGLAAKLEKVEQRKKTICGTPNYLAPEVLNRQGHGTE
SDVWSLGCVMYTLMCGNPPFETLDLKETYKCIKEVKYNLPSTLSPAAQKLISGILQKDPS
DRLTLDQILNHQFFTKAFTPDKLPPSSCVTVPELNPPSPAKRFFTKMAKSLFGKRKSKVE
KNHCEERESISKLVSGIVKCSISRQMSYKTVCTDEAPPPTVGQQVSSGLLDTPAEEESRK
SAASRSFKGTVASSTEPCEDGLTPASIAESAMKVLNSCLSAMPAATRNPPCLSRPKSFIW
VTKWVDYSNKYGFGYQLSNQNIGVLFNEGTHLSLCDQRTTVHYCLTNNKHFTFQASALPE
QLCSQKQIVELMANYMEQNLMEGGDLHCEDQPPSPPPLLLQWVKTDHALVMLFNNGTLQV
NFYTDHTKIILCKSSDSYLLTYISRERVSYTYLLSMLSEMGCSAELRHRMRYVVQLLQHH
GDS
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgaatactgcgtgttttaccacctctcagcgtacttcatgtctcacgatgaatccggat
ctattcaaaccttgtccagaacatggccaagttattattcctactaaaccgaacaagacc
aaatcggaacaaatcaaaccagatctcgcccaggtggtgactgattccaagacaggaaaa
tcttacagcaaaggaaagcttctgggaaagggtggctttgcacgatgctatgaaatgaca
gacctttccagcaacaaaatgtatgctgtgaaggtgataccacagagcagggtgtcaaaa
cctcatcagagggataagataacaaatgaaatcgaacttcacaaaaccctacatcacaaa
catgtggtgaagttctcccatcacttcgaagaccaagacaacatctatattttccttgag
ctctgcagtagaaagtccctggcacacatttggaaagcaagacacacattgacagaccca
gaagtgcggtactacctccggcagatcatatctgggctgaagtaccttcacaacagaggc
atccttcacagggatctcaaattaggcaatttctttgtgaatgagaacatggagttgcgt
ttgggagactttgggcttgctgcgaagttggaaaaagtcgagcagaggaagaaaacaatc
tgtggaacgccaaactaccttgcccccgaggtgttgaacaggcagggccatggaacagag
tctgacgtctggtcactaggttgtgtaatgtacacactgatgtgcgggaaccctcccttt
gaaacccttgacctgaaggagacatacaagtgtatcaaggaggtaaaatacaacctgccc
tcgaccctgtctcctgcggctcagaagctcatctctggcattttgcagaaggaccccagt
gaccgcctcacactagaccaaatcctgaaccaccaattcttcaccaaggctttcaccccg
gataaactgcctcccagcagctgtgtgacagtgccagagctcaacccgcccagccctgcc
aagaggtttttcacaaagatggccaagagtctctttggcaagagaaaatccaaagtggag
aagaaccattgtgaagagcgagagagcatctccaaacttgtgtcaggcatcgtcaaatgc
tccatcagtcgccagatgagttacaaaacagtttgcaccgatgaggctccccctcccacg
gtaggccagcaagtcagctctggtctgctggatacaccagctgaggaggagtccaggaag
tctgcagcatcacgctcctttaaaggcacggtggccagcagcacagagccgtgtgaagat
ggccttacccctgcgtctatagctgagtcggccatgaaggtcctcaacagctgtttgtct
gccatgcctgcagctacaagaaacccgccatgtctttccaggcccaaatcctttatctgg
gttacaaagtgggttgattattccaacaaatatggctttggctaccagctctccaatcaa
aacattggtgtgcttttcaatgaagggacacacttgagtctctgtgatcaacgcacgact
gtgcactactgcttgaccaacaacaaacacttcaccttccaggccagtgctttaccagag
cagctctgcagtcagaagcagatcgtggagctgatggccaactacatggaacagaacctc
atggagggtggcgatctccactgtgaagaccagcctccctccccgccgccactccttctg
cagtgggtgaagaccgaccatgctctggtgatgctcttcaacaacggtaccctgcaggtg
aatttctacaccgaccacaccaagatcatcctgtgcaagtcctccgactcttacctactg
acctacatcagccgcgaacgcgtctcctacacatacctcctgagcatgctgtcagaaatg
ggctgttctgccgagctgaggcaccgcatgcgctacgtggtccagctgctccaacatcac
ggagattcataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233220
Entry
112233220         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4-like
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112233220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233220
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112233220
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112233220
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112233220
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112233220
   Centrosome duplication proteins
    Regulators of centriole replication
     112233220
  Sister chromatid separation proteins
   Polo kinases
    112233220
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Plk4_PB1 Plk4_PB2 Pkinase_fungal POLO_box Kinase-like Toxin_ToxA Kdo Haspin_kinase DUF4520
Other DBs
NCBI-GeneID: 112233220
NCBI-ProteinID: XP_024256456
LinkDB
Position
Unknown
AA seq 916 aa
MSVSIGDKIEDFKVLTLLGKGSFACVYRAKSVNTGLEVAIKMIDKKAMHKSGMVQRVSNE
VEIQCRLKHPSILELYNYFEDSNYVYLVLEMCHNGEMSRYLKDRKMPFSEDDAQHFMHQI
VKGMLYLHTHGIMHRDLTLSNLLLTSNMNLKIADFGLATQLKLPSEKHFTMCGTPNYISP
EVATHSAHGLESDVWSLGCMFYAFLMGRPPFDTDTVKHTLNKVVLGEYDMPSHVSQEAQD
LIHQLLRKDPAQRPSLSAVLDHPFMTQSLLTRTKELSLGEPGSMDSGIATISTACTSSTS
GSSRLQKRAARHVIGPALPNRMAHIPTLPRPPSSACFEGVEQWQQHSDRVGRSRAVLGWE
SGRPHSRYLRRTHSSDRSSSSVTPDQGMGQAELERCHSEEMLTGSERLAFPMSSSYKDTP
QPFAEHGRLPSVPVKQTASSGCSYSIQPPHPLNLQLQESEGVQNWFSKEGQFPRPTDVNS
HSSSGSFHSGRDPLGVHNTWSDKPAGRGTSPHLHRNTSNTDSYRENGQPGHGEELQSLSK
PSVEKEKKSLRNVLPPLCASRLKSIRQKTKNAVVSILDTGEVCMELLKGQGPQERGKEVL
RISCDGLMVTIYQPNEGKGFPVLDRPPAPPEDILICSYEDLPEKYWKKYQYASKFVQLVK
SKTPKVTLYTKYGKCMLMENSPNADLEMCFYDGAKTHKTSELVRVVEKSGKSYTVKGEVG
LSGLSPESRLYVKLSDEGHSMCLSLETAITAEEQRCAKSTPFFPITLGRRPANPDSPCPL
GGVALVDVASPPKHLHITPSMISYDGSDFTSASVNKNCSPLSVKQDHTTNTGKVLKSVFV
PNIGWASQLTSGEVWVQFNDGSQLVVQAGVSCIAYTSPEGRTTRYKENEKLPELVKEKLH
CLSTILGLLASPAARR
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgagtgtttcaatcggcgataaaatcgaggatttcaaagttctcaccctccttggtaag
ggctcctttgcatgtgtttaccgggcaaagtcagtgaacactggcttggaggtggcgatc
aaaatgattgacaaaaaagccatgcataaatctggtatggtccagcgcgtcagtaacgaa
gtggagattcagtgtcgattgaagcatccgtcaatactagagctgtacaactactttgaa
gacagtaactatgtgtacttggtgttggagatgtgccataatggagagatgagtcgatac
ctgaaagacaggaagatgcccttctcagaggatgatgcacagcacttcatgcatcaaata
gtgaaaggtatgctgtacttgcatacacatggcatcatgcatcgggacctgaccttgtcc
aacctgctgctgacgagcaatatgaaccttaaaatagctgactttggcctggccactcag
ctgaagctccccagcgagaagcacttcaccatgtgtggcacacccaactacatctcccca
gaggtggccacccacagtgcccatggcctggagtctgatgtctggtctctgggctgtatg
ttctacgccttcctgatgggccggcccccatttgacacagacacagtgaagcacaccctc
aacaaggtggttctgggggagtatgacatgcccagccatgtgtcccaggaggcccaggac
cttatccatcagctgctgaggaaggaccctgcgcagcggcccagcctgtctgccgtgctt
gaccaccccttcatgacccaaagcctgcttaccaggaccaaggagctgagccttggtgag
ccaggctccatggacagcggcatcgccaccatctcgacagcctgcacctcatccacctca
ggcagcagccgtctccagaagagagcagccaggcatgtgatcggacctgccttgcccaac
cgcatggcacatatccccacattgccccggccgccaagcagcgcctgctttgagggggtt
gagcagtggcagcagcactccgacagagtagggaggagcagggcagttctgggctgggag
agtggacggccccactcccggtacctacggaggactcactcctcagaccggtctagctcc
tctgtcactccagaccaggggatggggcaggcagagctggagagatgccactctgaggag
atgctgactgggtcggagagactggcctttcccatgtcctccagctacaaggacactcca
caacccttcgcagagcatggaaggctcccatcggtgcctgtcaaacagacagccagctca
ggatgttcatattccatacaaccaccacatccactaaacctgcagttacaagagtcagaa
ggtgtacagaattggttcagtaaagaaggccagtttccgaggcccacggatgtcaactct
cacagcagcagtggcagtttccatagtggcagggatcctctaggtgtacacaacacctgg
agtgacaaaccggcaggcagaggcaccagtcctcacctccaccgcaacacctcaaacacg
gactcctacagggagaatgggcaacccggtcatggggaagagctgcagagtctatccaaa
ccaagtgtagaaaaggagaaaaagtccctgagaaatgtgctccctcctttgtgtgcctca
agactgaaatccatcagacagaagactaaaaacgctgtggtgagtattctggatacagga
gaggtgtgtatggagcttctcaagggccagggcccccaggagaggggcaaagaggtcctc
aggatatcctgtgatggtttgatggtcactatttaccagcccaatgaggggaagggtttt
cctgtgctagaccgcccccctgctccccctgaagacatcttgatctgcagctatgaggac
ctaccggagaagtactggaagaaataccagtatgcctccaagtttgtgcagctggtaaaa
tccaagactcccaaagttaccctctataccaagtatggtaaatgtatgctgatggagaac
tcccctaatgcagaccttgagatgtgcttctacgatggagcaaaaacccacaagacgtca
gagctggtccgtgtggtggagaagagtgggaagtcgtacacggtgaagggagaggtgggt
ctgagtggcctcagtccagagagcaggctgtacgtgaagctgtctgacgagggccacagc
atgtgtctgtctctagagacggcaatcactgcagaggagcagcgctgtgccaagagcact
cccttcttccccatcaccctcggccgaagacctgccaacccagactccccctgccccttg
ggcggtgttgcccttgtagatgtggcatcaccgcccaagcacctacacattactccctct
atgatctcatatgatgggtctgacttcacctcggctagcgtgaacaaaaactgctctccg
ctgtcggtcaaacaagaccacacaaccaacacagggaaagtgcttaagtccgtctttgtg
ccaaacattggttgggcctcacagctgaccagtggagaggtgtgggtgcagttcaacgat
ggctcccagctggtggtgcaggcaggggtctcttgtattgcctacacgtccccagaggga
cggaccaccaggtacaaagagaatgagaagttgccagagcttgtgaaggagaagctgcac
tgtctctccaccatcctgggcctgttagccagtccagcagcacgccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241904
Entry
112241904         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK1-like
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112241904
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112241904
   04114 Oocyte meiosis
    112241904
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112241904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112241904
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112241904
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112241904
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112241904
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112241904
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112241904
  Sister chromatid separation proteins
   Polo kinases
    112241904
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 112241904
NCBI-ProteinID: XP_024265682
LinkDB
Position
Unknown
AA seq 581 aa
MSAPVAKAVNPSTNVDPKSAPLKDIPDILLDPRTLKKYSRGRFLGKGGFAKCYEITDMET
KEVFAGKVVPKSMIVKPHQREKMSSEISIHKSLDNPHIVGFHGFFEDDDFVFVVLEICRR
RSLLELHKRRKAVTEPEARYYMMQLVKGCQYLHNNRVIHRDLKLGNIFLSDDMDVKIGDF
GLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDVWSLGCILYTLLVGKPPFETSC
LKETYNRIKKNNYTIPWQINPVAASLIKRMLHADPSQRPTVSQLQTDEFFTEGYIPLRLP
TTCLTVPPRFSIAPSSLEPSQRRPLTALNNKAGTEKVEQKDEPLLREIPEATDCHLSDLL
QQLDTCNAAKPSERGLIRMEEAEDPACVPIFWISKWVDYSDKYGLGYQLCDNSVGVLFND
CTRMIMYADGDSLQYIDKMAAESYLSVRSYPATLSKKITLLKYFRNYMSEHLLKAGANIT
PRDGDELARLPYLSHWFRTKSAIVLHLTNGTVQINFFQDHTKLILCPLMGAVSFIDEKRD
FRTYKMSLIEEFGCCKELASRMRYARLMVAKLLSCKSSTPH
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgagtgcgccggtcgccaaggcggtgaatccgtcgacaaacgtcgaccccaaatcggcg
cctctcaaagacatccctgatattctcctcgatccccggacactgaagaaatacagccgg
ggacgattcctcgggaaaggaggctttgccaaatgctacgaaatcacagatatggaaacc
aaagaggttttcgccggtaaagtcgtccccaaatccatgatagtcaaacctcaccagagg
gagaagatgagctctgaaatctccattcataagagtctcgacaatccgcacattgtggga
tttcacggctttttcgaggacgacgacttcgtgtttgttgtgttggaaatttgcaggcga
cggtctctgttggagctgcataagcgtcgtaaggctgtaacggagccggaggctcggtat
tatatgatgcagctggttaaaggctgccagtacctccacaacaacagagtgatacacaga
gacctgaaactaggaaacatcttcctcagcgacgacatggatgtcaagataggtgacttt
ggccttgccactaagatagagtttgatggggaacgtaagaagacgctgtgtggaacaccg
aactacatcgccccggaggttctctgtaagaaaggacacagcttcgaggtcgacgtctgg
tctctgggctgtatcctgtacactctgctggttggcaaacctccatttgagacgtcttgt
ctgaaggagacctacaaccgcatcaaaaagaacaactacaccatcccctggcaaatcaac
cctgtggcggcgtctctgatcaagcggatgctgcatgccgacccgtcccagcggcccacc
gtctcccagctgcagaccgatgagttcttcaccgaggggtacatccccctgcgtctcccc
accacctgcctcaccgtgcccccacgcttctccatcgctccctcctctctggagcccagc
cagagacgcccgctcaccgctctcaacaacaaggcagggacagagaaggtggagcagaaa
gatgagccactgctcagagagattcccgaggccacagactgccacctgagtgacctgctg
cagcaactcgacacctgcaacgctgccaagccctcggagagaggactcatacgcatggag
gaggcagaggacccagcctgtgtccccatcttctggatcagcaagtgggtcgactacagc
gacaaatacggactgggctatcagctgtgtgacaacagcgtgggggtgttgtttaacgac
tgtaccaggatgatcatgtacgctgacggagacagtcttcagtacatcgacaagatggct
gctgagagctacctcagtgtccgctcctaccctgctacgctatccaagaagatcacgttg
ttgaagtacttccgtaactacatgtcggagcaccttctgaaggcgggcgccaacatcacg
cctcgtgacggagacgagctggcccgtctgccgtacctcagccactggttcagaaccaag
tcggccatcgtcctccacctcaccaacggcaccgtgcagatcaacttcttccaggaccac
accaagttgatcctgtgtcctctgatgggtgctgtgtccttcatcgacgagaagagagac
ttccggacctataagatgtctctgatcgaggagtttggctgctgtaaggagctggccagc
aggatgcgatacgcccgactgatggtggccaaactactgtcctgcaagtcctccacgcct
cactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248580
Entry
112248580         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK2-like
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112248580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112248580
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112248580
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112248580
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112248580
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112248580
   Centrosome duplication proteins
    Regulators of centriole replication
     112248580
  Sister chromatid separation proteins
   Polo kinases
    112248580
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 112248580
NCBI-ProteinID: XP_024273492
LinkDB
Position
4
AA seq 658 aa
MELLRNIAEQPTNINRMCEPKLQGSCELRRKRTEDHGLAPAEMARIVTDHVSGKCYCRGK
VLGKGGFAKCYEMTDLSTSKVYAAKIIPHTRVSKPHQREKIDREIELHRVLHHKHIVHFY
HHFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDL
KLGNFFVSESMELKVGDFGLAAKLESAGNRKKTICGTPNYLSPEVLNKQGHGCESDVWAL
GCVMYTMLLGRPPFETTNLKETYRCIREARYSLPSSLSPQAKQLISSLLAKTPEDRPHLD
HILRHEFFTQGFVPERLPASCCHSAPEFHVSSPAKSFFKKAAAALFGGKRDKVKYYETLN
KLTKEEEEIYKLRHDLKKTVISQQTKQITEDGRPLSPSAGRPVAPSTEGLPPTTRDPIRL
IVRGSLGSCSSSSECLEDSTTGSVAETVASVLRGCLENMPKAGDLPKGIECSNLQWVTKW
VDYSNKYGFGYQLSDHIVGVLFNNGTHMSLLADKKTVHYYAELGQCSVFSTSDVPEHFVG
QVTVLKYFAHYMEENLMDGGDLVSQADTHMPRLYLLQWLKSDRALMMLFNDGTFQVNFYH
DHTKIILCTQREEYLLTYINEERVSSTFRLSSLLTSGCPADLRQRMEYSLNMLLQRFD
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggaattacttaggaatatcgctgaacagccgacgaatatcaacaggatgtgcgagccc
aaactgcaggggtcctgtgaactgcggagaaagaggacggaggatcacggtctggcacct
gcggagatggcgaggattgtcacggatcacgtcagcgggaaatgttactgccgtgggaaa
gttctgggaaagggaggtttcgccaagtgctatgagatgaccgacctgtccacgagtaaa
gtttacgcagcgaaaattattccccacacgcgcgtatccaaaccgcaccaacgggaaaag
attgacagggaaatcgagctacatagagttctccaccataaacacatcgtgcacttttac
catcatttcgaggacaaagataacatctacattctcctggaatactgcagtagaagatct
ttggcacacatcctgaaggcacgcaaagtgctcactgagcctgaagtgcgatactacctc
cgtcagatcgtctcagggctgaagtacctacatgagcaagagatcctgcacagagacctc
aaactgggtaacttctttgtgagtgagtcgatggagctgaaggtgggagactttgggctg
gctgccaagttggagtctgctgggaacaggaagaagaccatctgtgggacgcccaactac
ctgtcccctgaggtgctcaacaagcagggccatggctgtgagtcggacgtctgggccctg
ggctgtgtcatgtataccatgctcctgggcagacccccgtttgagaccaccaatctgaag
gagacgtacagatgtattcgggaggcgcgttactccctgccctcctccctgtcgccccag
gccaaacagctcatctccagcctcctggccaagactccagaggacagacctcacctggac
cacatactgcgccatgaattcttcacacagggtttcgtgccagagcgtctccctgctagt
tgttgccactctgctccagaattccacgtctccagccctgccaagagcttcttcaagaag
gcagcggctgccctcttcggcgggaaaagagacaaggtcaaatactacgagactctgaat
aaactcaccaaagaggaagaggagatctacaagcttcgacatgacctgaagaagacagtc
atcagccagcagaccaaacagattactgaggacggtaggccactgtcaccatctgctggg
aggccggtcgccccgtcaaccgagggcctgcccccgacgacacgagaccccatacggctt
attgtcaggggcagtctgggtagctgcagcagcagtagtgaatgtcttgaggacagcacc
accggcagtgtggctgagacagttgccagcgttctcagaggatgcctggaaaacatgccc
aaagcgggtgacctccctaaagggatagagtgcagtaacctgcagtgggtcactaagtgg
gtggactactccaacaagtatggctttggctaccagctctccgaccacatagtgggagtt
ttgttcaacaacgggacacacatgagcctcctcgcagacaagaagactgtccactactat
gctgagttgggtcagtgctctgtattctccacctctgacgtccctgagcactttgtaggt
caggtgaccgtcctcaagtactttgcccactacatggaagagaacctgatggatggtgga
gacctggtgagccaggcagacacacacatgcccagactctacctgctgcagtggctcaag
tctgaccgtgccctcatgatgctcttcaacgacggcacatttcaggtcaacttctaccat
gaccacactaagatcatcctgtgcacccagagggaggagtacttgctgacctacatcaac
gaggagcgtgtgtcctccaccttcagactgagctccctgctcacctccggctgccccgca
gacctgcgccaacgcatggagtactcactcaacatgctgctgcagcgcttcgactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256743
Entry
112256743         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4-like isoform X1
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112256743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112256743
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112256743
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112256743
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112256743
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112256743
   Centrosome duplication proteins
    Regulators of centriole replication
     112256743
  Sister chromatid separation proteins
   Polo kinases
    112256743
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Plk4_PB1 Plk4_PB2 Pkinase_fungal POLO_box Kinase-like Kdo
Other DBs
NCBI-GeneID: 112256743
NCBI-ProteinID: XP_024285968
LinkDB
Position
8
AA seq 955 aa
MSGKMFDKVIRYFFQNLTTKCKISEDEERILSTAGELQIEDFKVLTLLGKGSFACVYRAK
SVNTGLEVAIKMIDKKAMHKSGMVQRVSNEVEIQCRLKHPSILELYTYFEDSNYVYLVLE
MCHNGEMSRYLKDRKMPFSEGETRHFMHQIVKGMLYLHTHGIMHRDLTLSNLLLSVNMNL
KIADFGLATKLKLPSEKHFTMCGTPNYISPEVATHSAHGLESDVWSLGCMFYAFLMGRPP
FDTDTVKHTLNKVVLGEYDMPSHVSQEAQDLIHQLLRKDPAQRPSLSAVLEHPFMTQSLL
ARTKELSLGEPGSMDSGIATISTACTSSTSGSSSSSSSRHLQRRTRRVMGPALPNRMMPI
PTLPRPPSNACFEGVEQWQQQHSDRVGRSRAAPGGESGRPHSRYPRRAHSSDRSSSSVTP
AQGMGQAKLERCHSEEMLTVSGRLAFPMSSSYKDTPQPFAEHGRLPLPPVKQTASSGCSY
STQPPHPLNLQLEESEGVQNWFSKEGPFPRPTDVSSHSSSGSFHSSREPLGVHNYWSDKP
AGRGTSSHRNHNQHHPSNTESYWENGQQVHGGELQSLSKPKPSIAKEKSLRNVLPPLCAY
RLKPIRQKTKNAVVSILDTGEVCMELLRGQGPQERVKEVLRISCDGSMVTIYQPNEGKGF
PVLERPPAPPENILICSYEDLPEKYWRKYQYASKFVLLVKSKTPKVTLYTKSAKCMLMEN
SPNADLEVCFYDGAKIHKTSELVRVVKRGKSYTVKGEVGLSGLSPESRLYVELSDEGHSM
CLSLEAAITAEEQHSAKSTPFFPITIGRRPANPDSSCPSSQPATADVASLPQPPCFTPSR
ISYEESDITSASVNKNCSPLSVKQDHTANAGKVLKSVFVPNIGWASQLTSGEVWVQFKDG
SQLVVQAGVSCIIYTSPEGRTTRYKENEKLPELVKEKLHCLSTILGLLASPAARR
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgtcagggaagatgttcgacaaagttattcgttatttctttcaaaacctgacaactaaa
tgcaaaatcagtgaagatgaggagagaatcttatctacagctggggagttacagattgag
gacttcaaagttctcacactccttggtaagggctcctttgcatgtgtttaccgggcaaag
tcagttaacactggcttggaggtggcaatcaaaatgattgacaaaaaagcaatgcacaaa
tctggtatggtccagcgtgtgagtaacgaagtggagattcagtgtcgattgaagcatccg
tcaatactagagctgtacacctactttgaagacagtaattatgtgtacttggtgttggag
atgtgccataatggagagatgagtcgatacctgaaagataggaagatgcccttctcagag
ggtgaaacaaggcacttcatgcatcaaatagtgaaaggtatgctgtacttgcatacacat
ggcatcatgcatcgggacctgaccttgtccaacctgcttctgtcggtcaatatgaacctt
aaaatagctgactttggcctggccaccaagctgaagctccccagcgagaagcacttcacc
atgtgtggcacacccaactacatctccccagaggtggccacccacagtgcccacggcctg
gagtctgatgtctggtctctgggctgcatgttctacgccttcctgatgggccggccaccg
tttgacacagacacggtcaagcacaccctcaacaaggtggttctgggggagtatgacatg
cccagccatgtgtcccaggaggcccaggacctgatccatcagctgctgaggaaggaccct
gcgcaacggcccagcctgtctgccgtgctggagcaccccttcatgacccaaagcctgctg
gccaggaccaaggagctgagcctgggggagccaggctccatggacagcggcatcgccacc
atctccacagcctgcacctcgtccacgtctggcagcagcagcagcagcagcagccgccat
ctccagaggagaaccaggcgtgtgatgggacctgccttgcccaatcgcatgatgcctatc
cctacactgccccggccgcccagcaacgcctgctttgagggggttgagcagtggcagcag
cagcactcagacagagtaggcaggagcagagctgctccgggtggggagagtggacggccc
cactccaggtacccacgaagggctcactcctcagaccggtctagctcctctgtcactcca
gcccaggggatggggcaggcaaagctggaaaggtgccactctgaggagatgctgactgtg
tcagggagactggcctttcccatgtcctccagctacaaggacactccacaacccttcgca
gaacatggaaggctcccattgccacctgtcaaacagacagccagctcaggatgttcatat
tccacacaaccaccacatccactaaacctgcagttagaagagtcagaaggtgtacaaaat
tggttcagtaaagaaggcccgtttccgaggcccacggatgtcagctctcacagcagcagt
ggcagtttccatagcagcagggagcctctaggtgtacacaactactggagtgacaaacca
gcaggcagagggaccagttctcaccgcaaccacaaccagcaccacccctcaaacactgag
tcctactgggagaatgggcaacaagtacatgggggagagctgcagagtctgtccaaaccc
aaaccaagtatagcaaaggagaagtccctgagaaatgtgctccctcccctgtgtgcctac
agactgaaacccatcagacagaagactaaaaacgctgtggtgagcattcttgatacagga
gaagtgtgtatggagcttctcaggggccagggcccccaggagagagtcaaagaggtcctt
aggatatcctgtgatggttcgatggtcactatttaccagcccaatgaggggaaaggtttt
cctgtactagagcgcccccctgctcctcctgaaaacatcttgatctgcagctatgaggac
ttaccagaaaaatactggaggaaataccagtatgcctccaagtttgtgctcctggtgaaa
tccaagactccaaaggtcaccctctataccaagtctgctaagtgtatgctgatggagaac
tcccccaatgcagacctggaggtgtgcttctacgatggagcaaaaatccacaagacgtcg
gagctggtccgggtggtgaagcgtgggaagtcgtacacagtgaaaggggaggtgggtctg
agtggcctcagcccagagagcaggctgtatgtggagctgtctgacgagggccacagcatg
tgtctgtctctagaggcggcaatcactgcagaagagcagcacagtgccaagagcactccc
ttcttccccatcaccatcggcaggagacctgccaacccagactcctcctgcccctcgtcc
cagcctgccactgctgatgtggcatcactgccccagcccccatgtttcactccctctagg
atctcctatgaagagtctgacatcacctcagccagtgtgaacaaaaactgctctccgctg
tcggtcaaacaagaccacacggccaacgcagggaaagtcctcaagtctgtctttgtgcca
aatattggttgggcctcacagctgaccagtggagaggtgtgggtgcagttcaaagatggc
tcccagctagtggtgcaggcaggggtttcctgtattatctacacgtccccagagggacgg
accaccaggtacaaggagaatgagaagttgccagagcttgtgaaggagaagctgcactgt
ctctccaccatcctgggtctgttggccagtccagcagcacgccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260461
Entry
112260461         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK3-like
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112260461
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112260461
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260461
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112260461
   03400 DNA repair and recombination proteins [BR:otw03400]
    112260461
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112260461
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112260461
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    112260461
DNA repair and recombination proteins [BR:otw03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112260461
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 112260461
NCBI-ProteinID: XP_024291365
LinkDB
Position
10
AA seq 662 aa
MDTPCFATSQGSSCLTMNPNLFKPCPEREVIPPTKPNRTKSEQIKPELAQVVTDSKTGKC
YSKGKLLGKGGFARCYEMTDLSNKKMYAVKVIPQSRVSKPHQREKITNEIELHKTLHHKH
VVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEVRYYLRQIISGLKYLHNRGI
LHRDLKLGNFFVNENMELRLGDFGLAAKLEPVEQRKKTICGTPNYLAPEVLNRQGHGTES
DIWSLGCVMYTLMCGNPPFETLDLKETYKCIKEVKYNLPSTLSPAAQKLISGILQKNPSD
RLTLDQILNHQFFTKAFTPDKLPPSSCVTVPELNLPSPAKKFFTKMAKSLFGKRKSKVDN
SHCEERESISKLVSGIVKCSISRQISYKTVGANEPPTLTVGQQVGSGPLDIPAEEESRKS
AASGSFKGTVASSTEPCEDGVTPAAIAESAMKVLNSSLSAMPAATRNPPCLSRPKSFIWV
TKWVDYSNKYGFGYQLSNQDIGVLFNEGTHLSLCDQRKTVHYCMTNNKHFTFQASALPEQ
LCSQKQIVELMANYMEQNLMEGGDLHCEEQPPSQPPLLLQWVKTDHALVMLFNNGTLQVN
FYTDHTKIILCKSSGSYLLTYISRERVSYTYLLSMLSELGCSAELRHRMRYVVQLLEHHA
DS
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggataccccatgtttcgccacctctcagggtagttcatgtctcacgatgaatccgaat
ctattcaaaccctgcccagaacgtgaagttattcctcctactaaaccgaacaggactaaa
tcagaacaaatcaaaccagaactcgcccaggtggtgacagattccaagacggggaagtgt
tacagcaaaggaaagcttctggggaagggtggctttgcacgatgctatgaaatgacagac
ctttctaacaagaaaatgtatgctgtaaaggtgataccacagagcagggtgtcaaaacct
catcagagagagaagataacaaatgaaatcgagcttcacaaaacccttcatcacaagcat
gtggtcaagttctcccatcattttgaagaccaagacaacatctatattttccttgaactc
tgcagtagaaagtccctggcacacatttggaaagcaagacacacactgacagacccagaa
gtgcggtactacctccggcagatcatttctgggctgaagtaccttcacaataggggcatc
cttcacagggatctcaaattagggaatttctttgtgaatgagaacatggagttgcggtta
ggggacttcggcctggcagcaaagttggaaccagttgagcagaggaagaaaactatatgt
ggaacacctaactaccttgcacctgaggtgttgaacaggcagggccatggaacagagtct
gacatctggtcactaggttgtgtaatgtacacgctgatgtgtgggaaccctccctttgaa
acccttgatctcaaagagacgtacaagtgcataaaggaagtgaaatacaacctgccctca
acactgtctcctgctgctcagaaactcatctctggcattctgcagaagaaccccagcgac
cgcctcacactggaccaaatcctcaaccaccaattcttcacaaaagctttcaccccagac
aagctgcctcccagcagctgtgtgacagtgccagagctcaacctgcccagccctgccaag
aagtttttcaccaagatggccaagagtctttttggaaagagaaaatccaaagtggataac
agccattgtgaagagcgggagagcatctccaagcttgtgtctggcatcgtcaaatgctcc
attagtcgccagataagctataaaacagttggagccaatgagcctcccactctcacagta
ggccagcaagtcggctctggtccgctggatattccagctgaggaagagtccaggaagtcc
gcagcatcaggctcctttaaaggcacagtggccagcagcacagaaccgtgtgaagatggc
gttacccctgctgctatagcggagtcagccatgaaggtcctcaacagctctttgtctgcc
atgcctgcagctacaagaaatccaccttgtctctccagacccaaatcatttatctgggtc
acaaaatgggttgattattccaataaatatggctttggctaccagctctcaaatcaagac
attggtgtgctcttcaacgaggggacacacttgagtctgtgtgatcagcgcaagactgtg
cactactgcatgaccaacaacaaacacttcaccttccaggccagtgctttaccagagcag
ctctgcagccagaagcagattgtggagcttatggccaactacatggaacagaacctcatg
gagggtggagacctccactgtgaagaacagcctccctcccagccaccgctccttctacag
tgggtgaagaccgaccatgctctggtgatgctcttcaacaacggtactctgcaggtgaat
ttctacactgaccacaccaagatcatcctgtgcaagtcttctggctcctacctactgacc
tacatcagccgagagcgtgtgtcctacacctacctcctgagcatgctgtcagagctgggc
tgttctgccgagctgcggcaccgcatgcgttacgtggtccagctactcgaacaccatgca
gattcataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261726
Entry
112261726         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4-like
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112261726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112261726
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112261726
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112261726
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112261726
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112261726
   Centrosome duplication proteins
    Regulators of centriole replication
     112261726
  Sister chromatid separation proteins
   Polo kinases
    112261726
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Plk4_PB1 Plk4_PB2 Pkinase_fungal POLO_box Kinase-like Toxin_ToxA Kdo Haspin_kinase DUF4520
Other DBs
NCBI-GeneID: 112261726
NCBI-ProteinID: XP_024293079
LinkDB
Position
11
AA seq 916 aa
MSVSIGDKIEDFKVLTLLGKGSFACVYRAKSVNTGLEVAIKMIDKKAMHKSGMVQRVSNE
VEIQCRLKHPSILELYNYFEDSNYVYLVLEMCHNGEMSRYLKDRKMPFSEDDAQHFMHQI
VKGMLYLHTHGIMHRDLTLSNLLLTSNMNLKIADFGLATQLKLPSEKHFTMCGTPNYISP
EVATHSAHGLESDVWSLGCMFYAFLMGRPPFDTDTVKHTLNKVVLGEYDMPSHVSQEAQD
LIHQLLRKDPAQRPSLSAVLDHPFMTQSLLTRTKELSLGEPGSMDSGIATISTACTSSTS
GSSRLQKRAARHVIGPALPNRMAHIPTLPRPPSSACFEGVEQWQQHSDRVGRSRAVLGWE
SGRPHSRYLRRTHSSDRSSSSVTPDQGMGQAELERCHSEEMLTGSERLAFPMSSSYKDTP
QPFAEHGRLPSVPVKQTASSGCSYSIQPPHPLNLQLQESEGVQNWFSKEGQFPRPTDVNS
HSSSGSFHSGRDPLGVHNTWSDKPAGRGTSPHLHRNTSNTDSYRENGQPGHGEELQSLSK
PSVEKEKKSLRNVLPPLCASRLKSIRQKTKNAVVSILDTGEVCMELLKGQGPQERGKEVL
RISCDGLMVTIYQPNEGKGFPVLDRPPAPPEDILICSYEDLPEKYWKKYQYASKFVQLVK
SKTPKVTLYTKYGKCMLMENSPNADLEMCFYDGAKTHKTSELVRVVEKSGKSYTVKGEVG
LSGLSPESRLYVKLSDEGHSMCLSLETAITAEEQRCAKSTPFFPITLGRRPANPDSPCPL
GGVALVDVASPPKHLHITPSMISYDGSDFTSASVNKNCSPLSVKQDHTTNTGKVLKSVFV
PNIGWASQLTSGEVWVQFNDGSQLVVQAGVSCIAYTSPEGRTTRYKENEKLPELVKEKLH
CLSTILGLLASPAARR
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgagtgtttcaatcggcgataaaatcgaggatttcaaagttctcaccctccttggtaag
ggctcctttgcatgtgtttaccgggcaaagtcagtgaacactggcttggaggtggcgatc
aaaatgattgacaaaaaagccatgcataaatctggtatggtccagcgcgtcagtaacgaa
gtggagattcagtgtcgattgaagcatccgtcaatactagagctgtacaactactttgaa
gacagtaactatgtgtacttggtgttggagatgtgccataatggagagatgagtcgatac
ctgaaagacaggaagatgcccttctcagaggatgatgcacagcacttcatgcatcaaata
gtgaaaggtatgctgtacttgcatacacatggcatcatgcatcgggacctgaccttgtcc
aacctgctgctgacgagcaatatgaaccttaaaatagctgactttggcctggccactcag
ctgaagctccccagcgagaagcacttcaccatgtgtggcacacccaactacatctcccca
gaggtggccacccacagtgcccatggcctggagtctgatgtctggtctctgggctgtatg
ttctacgccttcctgatgggccggcccccatttgacacagacacagtgaagcacaccctc
aacaaggtggttctgggggagtatgacatgcccagccatgtgtcccaggaggcccaggac
cttatccatcagctgctgaggaaggaccctgcgcagcggcccagcctgtctgccgtgctt
gaccaccccttcatgacccaaagcctgcttaccaggaccaaggagctgagccttggtgag
ccaggctccatggacagcggcatcgccaccatctcgacagcctgcacctcatccacctca
ggcagcagccgtctccagaagagagcagccaggcatgtgatcggacctgccttgcccaac
cgcatggcacatatccccacattgccccggccgccaagcagcgcctgctttgagggggtt
gagcagtggcagcagcactccgacagagtagggaggagcagggcagttctgggctgggag
agtggacggccccactcccggtacctacggaggactcactcctcagaccggtctagctcc
tctgtcactccagaccaggggatggggcaggcagagctggagagatgccactctgaggag
atgctgactgggtcggagagactggcctttcccatgtcctccagctacaaggacactcca
caacccttcgcagagcatggaaggctcccatcggtgcctgtcaaacagacagccagctca
ggatgttcatattccatacaaccaccacatccactaaacctgcagttacaagagtcagaa
ggtgtacagaattggttcagtaaagaaggccagtttccgaggcccacggatgtcaactct
cacagcagcagtggcagtttccatagtggcagggatcctctaggtgtacacaacacctgg
agtgacaaaccggcaggcagaggcaccagtcctcacctccaccgcaacacctcaaacacg
gactcctacagggagaatgggcaacccggtcatggggaagagctgcagagtctatccaaa
ccaagtgtagaaaaggagaaaaagtccctgagaaatgtgctccctcctttgtgtgcctca
agactgaaatccatcagacagaagactaaaaacgctgtggtgagtattctggatacagga
gaggtgtgtatggagcttctcaagggccagggcccccaggagaggggcaaagaggtcctc
aggatatcctgtgatggtttgatggtcactatttaccagcccaatgaggggaagggtttt
cctgtgctagaccgcccccctgctccccctgaagacatcttgatctgcagctatgaggac
ctaccggagaagtactggaagaaataccagtatgcctccaagtttgtgcagctggtaaaa
tccaagactcccaaagttaccctctataccaagtatggtaaatgtatgctgatggagaac
tcccctaatgcagaccttgagatgtgcttctacgatggagcaaaaacccacaagacgtca
gagctggtccgtgtggtggagaagagtgggaagtcgtacacggtgaagggagaggtgggt
ctgagtggcctcagtccagagagcaggctgtacgtgaagctgtctgacgagggccacagc
atgtgtctgtctctagagacggcaatcactgcagaggagcagcgctgtgccaagagcact
cccttcttccccatcaccctcggccgaagacctgccaacccagactccccctgccccttg
ggcggtgttgcccttgtagatgtggcatcaccgcccaagcacctacacattactccctct
atgatctcatatgatgggtctgacttcacctcggctagcgtgaacaaaaactgctctccg
ctgtcggtcaaacaagaccacacaaccaacacagggaaagtgcttaagtccgtctttgtg
ccaaacattggttgggcctcacagctgaccagtggagaggtgtgggtgcagttcaacgat
ggctcccagctggtggtgcaggcaggggtctcttgtattgcctacacgtccccagaggga
cggaccaccaggtacaaagagaatgagaagttgccagagcttgtgaaggagaagctgcac
tgtctctccaccatcctgggcctgttagccagtccagcagcacgccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262795
Entry
112262795         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK2-like
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112262795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112262795
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112262795
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     112262795
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   112262795
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112262795
   Centrosome duplication proteins
    Regulators of centriole replication
     112262795
  Sister chromatid separation proteins
   Polo kinases
    112262795
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 112262795
NCBI-ProteinID: XP_024294330
LinkDB
Position
12
AA seq 660 aa
MELLRNISQQPTNSNRMYEPNQPGSCELRRKRTEDHGHAPAEMSKIITDPATGKCYCRGK
VLGKGGFAKCYEMTDLSTSKVYAAKIIPHTRVSKPHQREKIDREIELHRVLHHKHIVHFY
HHFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDL
KLGNFFVSETMELKVGDFGLAAKLEPAGNRRKTICGTPNYLSPEVLNKQGHGCESDVWAL
GCVMYTMLLGRPPFETTNLKETYRCIREARYSLPSSLSPQAKQLISSLLAKTPEDRPHLD
HILRHEFFSQGFVPERLPASCCHSAPEFHVSSPAKSFFKKAAAALFGGKRDKVKYYETLN
KLTKEEEEIYKLRHDLKKTVISQQQQIKQMTEDGRPPSPSAGRPVALATEGLPPTTRDTI
RLIVRGSLGSCSSSSECLEDSTTGSVAETITSVLRGCLENMPKADDIPKGTECSNLQWVT
KWVDYSNKYGFGYQLSDHIVGVLFNNGTHMSLLADKKTVHYYAELGQCSVFSTSDVPEHF
IGQVTVLKYFAHYMEENLMDGGDLVSQPDTHMPRLYLLQWLKSDRALMMLFNDGTFQVNF
YHDHTKIILCTQREEYMLTYINEERVSSTFRLSSLLTSGCPADLRQRMEYSLNMLLQRCN
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggaattactgaggaatatctctcaacagccgacgaatagcaacaggatgtacgagccc
aaccaacccgggtcctgtgaactgcggagaaagagaactgaggaccacggtcatgcacct
gcagagatgtcgaagattatcacggatcctgccaccgggaaatgttactgccgtgggaaa
gttctgggaaagggaggtttcgccaagtgctatgagatgaccgacctgtccacgagtaaa
gtttatgcagcgaaaattattccccacacgcgcgtctccaaaccgcaccaacgggaaaag
attgacagggaaatcgagctacacagagttctccaccataaacacatcgtgcacttttac
catcatttcgaggacaaagataacatctacatcctcctagaatactgcagtagaagatct
ttggcacatatcctgaaggcacgcaaagtgctcacagagccggaagtgcgatactacctc
cgtcagatcgtctcagggctgaagtacctgcatgaacaagagatcctacacagagacctc
aaacttggtaacttctttgtgagtgagacgatggagctgaaggtgggagactttgggctg
gctgccaagctagagcctgctgggaacaggaggaagaccatctgtgggacacccaactac
ctgtcccctgaggtgctcaacaagcagggccacggctgtgagtcagacgtctgggccctg
ggttgtgtcatgtacaccatgctcctgggcagacccccgttcgagaccaccaatctgaag
gagacgtacaggtgtatccgggaggcacgttactccctgccctcctccctgtcgccccag
gccaaacagctcatctccagcctcctggccaagaccccggaggacagacctcacctggac
cacatactgcgccatgagttcttctcacagggttttgtgccagagcgtcttcctgctagt
tgctgccactccgctccagagttccacgtctccagccctgccaagagcttcttcaagaag
gccgcggctgccctcttcggcgggaagagagacaaggtcaaatactacgagactctgaat
aaactcaccaaagaggaagaggagatctacaagcttcgacatgacctgaagaagacggtt
atcagccagcagcagcagatcaaacagatgactgaggatggaaggccaccgtcaccatct
gctgggaggcctgtcgccctggcaacagagggcctgcccccgacgacgcgagacaccatc
cggcttattgtcaggggcagtctgggtagctgcagcagcagtagcgaatgtctagaggac
agcaccactggcagtgtggctgagacaatcaccagtgttctcagaggatgcctggaaaac
atgcccaaagcggatgacatccccaaagggacagagtgcagtaatctgcagtgggtcact
aagtgggtggactactccaacaagtatggctttggctaccagctttcagaccacatagtg
ggcgttctgttcaacaacgggacacacatgagcctcctcgcagacaagaagactgtccac
tactatgctgagttgggtcagtgctctgtgttctccacatctgacgtgcctgagcatttc
ataggtcaggtgaccgtcctcaagtacttcgctcactacatggaagagaacctgatggat
ggtggagacctagtaagccagccagacacgcacatgcccagactctacctgctgcagtgg
ctcaagtctgaccgtgccctcatgatgctcttcaacgacggcacgtttcaggtcaacttc
taccacgaccacaccaagatcatcctgtgcacccagagggaggagtacatgctgacatac
atcaacgaggagcgtgtgtcctccaccttcagactgagctccctgctcacctccggctgc
cccgcagacctgcgccaacgcatggagtactcactcaacatgctgctgcagcgctgcaac
tga

DBGET integrated database retrieval system