KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220028
Entry
112220028         CDS       T05605                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220028
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112220028
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 112220028
NCBI-ProteinID: XP_024237350
LinkDB
Position
20
AA seq 326 aa
METVKLMRELIANFEQERNYLPKETGLRLIESTGENDSRGISAKCRDTKVEDLWSLTSFF
GYSTQTFVLAVNLLDRFLATMKVQPKYLACVGISCLHIAAKAVEEDCNLSSTNELIRISQ
CKFTVSDLTRMEKIVSEKLNFQLKTITALTFLHLYHGITSAHTSDLKEALNLDILEVQLK
ACLCRIAFSKAKPSVLALSLLTQEIEAMQSVEMLEIAHHVQRHLKITDAELLHWKGLVAK
CMSDYSSPECSKPNNKKLVWIVSRRTAQNLHTSYYSVPELPTIPEDCWDQGESEDSCEDM
SSGEESLSSSLGSDAEGPYFPRNFLC
NT seq 981 nt   +upstreamnt  +downstreamnt
atggaaactgtgaaacttatgagggagttgatagccaattttgaacaggagaggaattat
cttccgaaggaaacaggactccgcttaatcgaatcgactggagagaatgacagcagggga
atatcagctaaatgtagggacaccaaagtggaggacctctggagcctgactagtttcttt
gggtacagtacacagacttttgttctggcagtcaacctgttggatcgattcctggccacg
atgaaggtccaacccaaatatctagcttgcgtcggcatcagctgcctccacatcgcagcc
aaagcagtcgaagaggattgtaacttgtcttccaccaatgagcttattcgtatcagccag
tgcaagtttacggtctctgacctcactcgcatggagaagattgtttcagagaaactcaac
ttccaactcaaaaccatcacagccttaacgtttttgcacctataccacggaatcacaagt
gcccatacttcagacctgaaggaggccctgaatctcgacatactagaggtccagctcaaa
gcctgtctctgccggatcgcgttctccaaagctaaaccgtcagtcttggccctgtcactc
ctcactcaggagattgaagccatgcagtctgttgagatgttagaaatagcacatcatgtt
caaagacatctcaagatcaccgacgctgagctgctacactggaagggactagtggccaag
tgtatgtccgactactcttctcccgaatgtagcaaacccaacaataaaaagcttgtctgg
atcgtgtcgagaaggacagctcagaatcttcacaccagctactacagcgtccctgaactg
ccaaccattcctgaggactgctgggatcagggtgaaagtgaagactcatgtgaagacatg
agttcgggggaggagagcctgagcagttccctgggctctgacgcggaggggccttacttc
cctcgaaacttcctctgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232838
Entry
112232838         CDS       T05605                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112232838
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112232838
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 112232838
NCBI-ProteinID: XP_024255857
LinkDB
Position
Unknown
AA seq 337 aa
MRDLQYLDNETCWLVKELKSNISQESYFLPRETGLNIMESAAENHNGVSAKCRNAKVEDL
WSLTSFFGFSTQTFVLAVNLLDRFLAIMKVQPKHLPCIGVSCLHIAAKMVEDECNISPTH
ELIRISQSKFTVSDLSRMEKIISGKLHLELKAVTALTFLHLYHAVIVSLTSEREEIPSIG
RLEAQLKACLCQLVFSKAKPSVLALSVVCQEFEALQSLAMLEIVQDVQRHLKIVDSELLY
WRGLVAKCMTEYCSSECNKPDNKKLVWIVSRRTAQNLHANNFSVPELPTIPEGSWGESES
EDSCEDMSCEEDSPCSSPGSDEKGAFFPVEFRNQGRK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcgggatcttcaataccttgacaatgaaacatgttggcttgtcaaagagctgaagtca
aacatttctcaagaatcatactttttacctagggaaactggcctgaatataatggagtct
gcagcagagaatcacaatggagtctctgcaaaatgcagaaatgccaaagttgaagacttg
tggagcctgaccagtttctttggtttcagcacccagacatttgttctggctgtcaatcta
ctggataggttcttagccattatgaaggtccaacctaagcatctgccttgcattggagtc
tcctgcctccatattgctgccaaaatggttgaggatgagtgtaacatctcacccacccat
gaactcatccgcatcagccaaagcaagttcactgtttctgacctcagccgcatggagaag
ataatctctggaaaactccatttggagctcaaagccgtcacagccttaacttttttacac
ttataccatgctgtcatcgtatcacttacatcagaaagggaggagatcccaagcattggg
agactggaagcccagctaaaggcctgcttatgtcagcttgttttctctaaagcaaaacca
tctgtgctggcactgtctgtcgtttgtcaggagtttgaagccctccagtctcttgccatg
ttggaaattgtccaagatgtccaaaggcacctaaagattgttgacagtgagttactctac
tggaggggacttgtggccaaatgcatgactgagtactgctcaagtgaatgtaacaaacca
gacaacaaaaaactggtgtggatcgtgtccagacgaactgcccaaaatttgcacgctaat
aacttcagtgtccctgaactgccgaccattccagaggggagctggggtgaaagtgagagt
gaggattcctgtgaggacatgagctgtgaagaggacagcccgtgcagctctcctggcagc
gatgaaaagggagccttcttccccgtagagtttcgcaaccagggcagaaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257322
Entry
112257322         CDS       T05605                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112257322
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112257322
SSDB
Motif
Pfam: Cyclin_N Imm68
Other DBs
NCBI-GeneID: 112257322
NCBI-ProteinID: XP_024286582
LinkDB
Position
9
AA seq 295 aa
MEAVKLMRELKTNFEQEMNYLPKETGLHLIESTRENASQGISAKCRDVKVEDLWSLTSFF
GYSTQTFVLAVNLLDRFLAMMKVQPKHLACISISCLHIAAKAVEEDCNLSSTNELIRISQ
CKFTVSDLTRMEKIISEKLNFQLEAITALTFLHLYHRITRSHTSDRKEALNLDTLEAHLK
ACLCRITFSKAKPSILALSLLTQEIEAMQSVDMLEIAHSVQRHLKITDTELLHWRGLVAK
CLSDYSSPECSRPNNKKLVWIVSRRTAQNLHTSYCNVPELPTIPEDCWDQSEELV
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaagccgttaaacttatgagggagctgaaaaccaattttgaacaggagatgaattat
cttccgaaagaaacgggactccacttgatcgaatcaaccagagagaatgccagccaagga
atctcagctaaatgtagggacgtcaaagtggaagacctctggagcctaaccagtttcttt
gggtacagcacccagaccttcgttctggcagtcaacctgctagatagatttttggccatg
atgaaggtccaacccaaacatctagcctgcattagcatcagctgcctccacatcgcagcc
aaagcagtcgaagaggattgtaacttgtcttccaccaatgaacttattcgtatcagccag
tgcaagtttacggtctcggacctcactcgcatggagaagatcatttcagagaaactcaac
ttccaactcgaagccatcacagccttaacctttttgcacctataccatagaatcacacgc
tcacacacctcagacaggaaggaagccctgaacctcgacacactagaggcccacctcaaa
gcctgcctctgccgcatcacattctccaaagctaaaccgtccatcttggccctgtccctc
ctcactcaagagattgaagccatgcagtctgttgacatgctagaaatagcacatagtgtt
cagcgacatctcaagatcaccgacacggagctgctacactggagggggctagtggccaag
tgtctgtctgactactcttcccctgaatgtagcagacccaacaataagaagctcgtctgg
atcgtgtcgagaaggaccgctcagaacctacacaccagctactgcaacgtccctgaactg
ccgaccattcccgaggactgctgggaccaaagcgaggaactcgtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263138
Entry
112263138         CDS       T05605                                 

Definition
(RefSeq) cyclin-G2-like isoform X1
  KO
K10146  cyclin G2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112263138
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112263138
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 112263138
NCBI-ProteinID: XP_024294913
LinkDB
Position
12
AA seq 353 aa
MDVGSSCKRQTVFKYRMQDLQDLDNETCWLVKELKSYIAQEADFLPRETGLNIMESAAEN
HNGVSAKCRNAKVEDLWSLASFFGFSTQTFVLAVNLLDRFLAIMKVQPKHVPCIGVSCLH
IAAKMVEDECNISPTHELIRISQSKFTVSDLSRMEKIISEKLNLELKAITALTFLHLYHA
VIVSLTSERGEIPSIERLEAQLKACLCQLIFSKAKPSVLALSVITQEFDALQSLAMLEIV
QELQRHLKIVDSELLYWRGLVAKCMTEYSSSECNKPDNKKLVWIVSRRTAQNLHANHFSV
PELPTIPEGSWDESESEDSCEDMSCEEDSLCGSPGSDAEGAFFPSEFCNQGRK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggatgtcggttcatcgtgcaaaaggcagactgttttcaaatacaggatgcaggatctt
caagaccttgacaatgaaacatgttggcttgtcaaagagctaaagtcatacattgctcaa
gaagcagactttttaccgagggaaactggcctcaatataatggagtctgcagcagagaat
cacaatggagtctctgcaaaatgcagaaatgccaaagttgaagacttgtggagcctggcc
agtttctttggtttcagcacccagacatttgtcctagctgtcaatctactggataggttc
ttagccattatgaaggtccaacctaagcacgtgccctgcattggagtctcctgtctccat
attgctgccaaaatggttgaggacgagtgcaacatctcacccacccatgaactcatccgc
atcagccaaagcaagttcactgtgtctgacctcagccgaatggagaagatcatctctgaa
aaactcaacttggagctcaaagccatcacagccttaacttttttacacttataccatgct
gtcattgtatcacttacatcagaaaggggggagatcccaagcattgaaagactggaagcc
cagctaaaagcctgcttatgccagcttattttctctaaagcaaaaccatcggtgctggca
ctgtctgtcattactcaggaatttgatgccctccagtctcttgccatgttggaaattgtc
caagaactccaaaggcacttaaagattgttgacagtgagttactctactggaggggactc
gtggccaaatgcatgactgagtacagctcaagtgaatgtaacaaaccagacaacaaaaaa
ctggtgtggatcgtgtccagacgaaccgcccaaaatttgcacgctaatcacttcagtgtc
cctgaactgccgactattccagagggcagctgggatgaaagtgagagtgaggattcctgt
gaggatatgagctgtgaagaggacagcctgtgcggctctcctggcagtgatgcagaggga
gccttcttcccctcagagttttgcaaccagggcagaaaatga

DBGET integrated database retrieval system