KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220194Help
Entry
112220194         CDS       T05605                                 

Definition
(RefSeq) DNA ligase 4-like
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    112220194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:otw03400]
    112220194
Enzymes [BR:otw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112220194
DNA repair and recombination proteins [BR:otw03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     112220194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT_2 RNA_ligase BRCT DUF4607
Motif
Other DBs
NCBI-GeneID: 112220194
NCBI-ProteinID: XP_024237657
LinkDB All DBs
Position
20
AA seq 914 aa AA seqDB search
MEGTSKSESAAPQSSVAAQVPFLHLCTTLEKIQKTKFRPDKSKFLRDFIDSWRKFHAALH
KDNPTTPDSFYPAMRLIVPSFERERVAYGIKESMLAKLYIDVLGLPKNGPEANKLLNYRT
PTTSQGEAGDFALMTYFVLKKRCTSQGNLTIREVNDFLDSVAINNAGKQKDLVKKSLLHL
ITQSTALEQKWLIRMILKDMKLGVSKETVLRVFHLDAAELYNVTTDLNKVCRQLHDPFVS
LSEVSIGLFFAFKPMLAAVANMRQVEKQMGNSTFFIETKLDGERIQLHKDGDVYKYFTRN
SFEYTQQFGASPLEGSLTPFIHNVFKPHIVKCILDGEMMAYNPTTDTFMQKGSKFDIKRL
VDDSELQTCFCVFDVLLVNDHKFGNETLKVRHDNLQTVFTPVKGRIHVVPKTEAKTMQEV
VNALNEAIDNREEGIMVKDPSSVYKPDKRGEGWLKIKPEYVDGLMDELDLLIVGGYWGKG
RRGGMMSHFLVAVAEAPKPGEKPSVFHTLCRIGSGYTMKELYDLGLKLAKHWKVYRKNDP
PASILCGTERPEVYIDPCNSVIIQVKAAEIVSSEMYKTNCTLRFPRIEKIREDKEWHQCM
TLAELDQFRNKASGKLFSRHLRINDNDEPEKKKRKSPAAAKPKKAVGVIDHFKSQDLSGI
TKETDMFEDVEFCVMNGNEAHPKAELEKAVARCGGIVVQNPGPDTYCVIAAVENMRVKNL
ISSDQHDVVWAAWLLVCLDRKQVVPWQPRHMIHISPSTKEHFAKEYDCYGDSYFVDTDEQ
QLREVFGRIGRVDTLTAQCIAKLEERFSWDDLPTSMFRPFRVYMDRYADIGDPKSIVPAT
CLDTRALEFRFHGGTVVQKLEEGVSHVIVVEETRVLALRTLRRLFTKKFKIVRESWVTES
IKAGFLRNDNDYLV
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggagggaacctcaaaaagcgaatctgctgctccccagagctctgtcgctgctcaagtt
ccatttcttcacctgtgcaccacgcttgaaaaaatacagaagaccaaattccgaccagac
aaatcaaagtttctccgtgacttcatagactcctggaggaagttccatgcagccctccac
aaagacaaccctaccaccccagactctttctacccggccatgcgtctcatagtcccctcg
ttcgaaagggagcgtgtggcctatggcattaaagagagtatgttagccaagctctacata
gacgtcttgggtctccccaagaatggaccggaagccaacaaactgttgaattaccgcacc
cccaccacatctcagggggaggcgggagacttcgctctcatgacctactttgtgttgaag
aaacgctgcacaagccagggaaacctcaccatcagagaagtcaacgactttctggactcg
gtggccatcaacaatgctggtaagcagaaggacctggtgaagaagagcctactgcacctt
atcacccagagcacggcactggagcagaagtggcttatccgcatgatcctgaaggacatg
aagctgggggtcagcaaagagaccgtgctccgggtgttccacttagatgcggccgagctc
tacaacgtcaccacagacctaaacaaggtgtgccggcagctccacgacccctttgtgtcc
ctcagcgaagtgtccattggcctgttctttgccttcaaacctatgctagccgccgtggcc
aacatgcgccaggtggagaagcagatgggcaacagcaccttcttcatagagaccaagctg
gatggagagcgcatccagctgcacaaggatggcgacgtctacaagtacttcacacggaac
tccttcgagtacacccagcagtttggtgcatcgccgctagagggctccctgacgcctttc
atccacaatgtcttcaagccccacatagtcaaatgcatcctggatggggagatgatggcg
tacaaccccactaccgacaccttcatgcaaaaaggaagcaagtttgacatcaagaggcta
gtggatgactccgagctccagacgtgcttttgcgttttcgatgtacttcttgtgaacgac
cacaagtttggcaacgagacgttgaaggtgcgccacgacaaccttcagactgtcttcact
cctgttaaagggaggatacacgtggtgccgaaaacggaggctaaaactatgcaagaggtg
gtaaacgccctcaacgaagccattgacaacagggaagagggcatcatggtgaaagatccc
tcatccgtctacaagcccgataagcgaggtgagggctggctcaagataaagccggagtac
gttgatggcttgatggatgagctcgacctgttgattgtcggaggctactggggaaaagga
aggcgaggtggcatgatgtctcatttcctcgtcgcggtggccgaagctccgaagcctgga
gagaaaccctccgttttccacacgctctgtcgcatcggttccggctacaccatgaaggag
ctgtatgacttggggttgaagctggccaagcactggaaagtctaccggaagaacgaccct
ccggcctctattctgtgtgggacggagagaccggaagtctacattgacccgtgcaactcg
gtcatcatccaggtgaaggcagcagaaatagtcagtagtgagatgtacaaaaccaactgc
acgctacgcttccccaggatcgagaagatccgggaggacaaagagtggcaccagtgcatg
accctagctgagctcgatcagtttcgcaacaaggcgtccgggaagttgttctcgcgccac
ctccgcatcaatgacaatgacgagcctgaaaagaagaagcgcaagtcgccggcagcggcc
aagcccaagaaagctgtcggcgtcatcgaccacttcaagtcccaggacctatctggcatt
accaaggagacggacatgttcgaggacgtggagttctgcgttatgaatggcaatgaggcg
caccccaaggcggagctggagaaagcagtggcccgatgtggcggtattgtagtccagaac
ccgggaccggacacctactgtgtgatcgccgctgtggagaacatgcgtgtgaagaacctg
atctcttcagaccagcacgacgtagtgtgggctgcctggctgctggtgtgcctagacagg
aagcaggtggtgccatggcaaccgcgtcacatgatacacatttcaccctccaccaaggag
cactttgccaaggaatatgactgctacggagacagctactttgtggacacggacgagcag
cagctgagggaagtcttcggtcggattggtagagtggacactttgacggcacagtgcatc
gctaagttggaggaacgcttcagctgggacgacctccccactagcatgttcagacctttc
agggtctacatggacagatacgcagacataggagaccctaaaagcattgtaccggcaact
tgtctggacacgcgggctctggaattccgcttccacggagggacagtagtgcagaagctt
gaggaaggggtctctcatgtcatcgtggtggaggaaacaagagtgttggctttaagaacc
ctcagacgactctttaccaaaaagttcaagattgttagagagtcatgggtaacagaatct
atcaaagcagggtttttgcggaatgacaatgactacctagtgtaa

DBGET integrated database retrieval system