KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220280
Entry
112220280         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 1-like isoform X1
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220280
SSDB
Motif
Pfam: WH1 GAS CALCOCO1 BLOC1_2 DUF4407 CENP-K DUF1664 DASH_Duo1 Fmp27_WPPW MAD Phage_GP20 DUF4795 Crescentin PriC
Other DBs
NCBI-GeneID: 112220280
NCBI-ProteinID: XP_024237816
LinkDB
Position
20
AA seq 367 aa
MCVAISGRLEQPIFSTRAHVFQIDPTTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGS
KAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSENHLLKFAEKFAEFKEAARLA
KEKSQEKMELTSTPSQESAIGDLQSPLTPESINGTDDERGTTPEMPQHPPEPRPEPSQNQ
LPFSHSSSSINKHWEAELAALKGNNAKLTAALLESTANVKQWKQQLAAYQEXAERLHKRV
TELECVRGQTPVIKSQKTELNQTIEELESALKAKEEELERLKEEVESANEFQTQKESLTH
KLQETEERNQTLEAQLGELELHLEGSQLESEAFRKSLRSLLELLDGKIFELTELRDSLAR
LIEDSSS
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtgtgtagcgatctctgggaggctagagcagcctatcttcagtacgagggcacatgtc
ttccagatcgaccccaccaccaagaagaactgggtccccaccagtaaacacgccgtcaca
gtctcctacttctacgacagcacgcgcaacgtctaccgcatcatcagtctggacggctct
aaggcaatcatcaacagcaccatcacccccaacatgaccttcaccaagacctcccagaag
tttggccagtgggccgacagccgagccaacaccgtctatggcctgggcttctcctcagag
aaccacctgctcaagtttgcagagaaatttgcagagtttaaagaggcggcccgattagcc
aaggagaaatcccaggagaagatggaactcaccagcaccccctctcaggagtcggccatc
ggtgacctgcagtcacctttgaccccggagagcatcaacggcactgatgacgagaggggt
accacccctgaaatgccgcagcacccacctgagccccgtcccgagccgtctcagaaccag
ctgcccttctcccacagttcgtccagtattaacaagcactgggaggccgagctggcagcc
ctgaagggcaacaatgccaagctgacagcagctctgctggagtccacagccaacgtcaaa
cagtggaaacaacaactggctgcttaccaggagmaggctgagagactacacaaacgggtg
acagagctggagtgtgttaggggtcagacgccagtcatcaaatcccagaagactgagctc
aaccagacgatagaagaactggagtcagcattaaaagccaaggaggaggaactagagagg
ttgaaagaggaagtggagagtgctaatgagttccagactcagaaggaatcgctaacacat
aaactacaggagactgaggagaggaaccagacgttggaggcccagctgggggagttggag
ctgcatctggagggcagtcagctagagagcgaggccttcaggaagagtctgcggtccctg
ctggagctgctggacgggaagatctttgagctgacagagctccgagacagcctagccaga
ctcatcgaggacagcagcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230821
Entry
112230821         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 1-like
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112230821
SSDB
Motif
Pfam: WH1 GAS DUF812 BLOC1_2 CENP-K MAD Crescentin DASH_Duo1 IFT57 DUF1664 DUF4201 LPP Rootletin Leu_zip AAA_13 DUF3461 FUSC Fmp27_WPPW NPV_P10 Nsp1_C
Other DBs
NCBI-GeneID: 112230821
NCBI-ProteinID: XP_024252920
LinkDB
Position
33
AA seq 360 aa
MGEQPIFSTRAHVFQIDPTTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSENNLLKFAEKFAEFKEAARLAKEKSQEK
MELTSTPSQESATGDLQSPLTPESINGTDDERGTTPETPQYLPEPRAEPSQNQLPFSHSS
SSINKHWEAELAALKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHTRVTELECVS
GQMTVIKSQKTELNQTIEELESALKSKEEELERLKEEVESANEFQTQKESLTQKLQETEE
RNQTLEAQLVELEQRLEGSQLEREAFRKSLRTLLELLDGKIFELTELRDSLARLIEGSSS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgggagagcagcctatcttcagtacgagggcccatgtcttccagattgaccccaccacc
aagaagaactgggttcccaccagtaaacacgccgtcacagtctcctacttctacgacagc
acgcgcaacgtctaccgcatcatcagcctcgacggctccaaggcaatcatcaacagcacc
atcacccccaacatgaccttcaccaagacctcccagaagtttggccagtgggccgacagc
cgagccaacaccgtctacggtctaggcttctcctcagagaacaacctgctcaagtttgca
gagaagtttgctgagtttaaagaggcagctcggttagccaaggagaaatcccaggagaag
atggaactcaccagcaccccttctcaggagtcagccaccggcgacctgcagtcacctttg
accccggagagcatcaacggcactgatgacgagaggggcaccacccccgaaacgccgcag
tacctccccgagccccgtgccgagccgtcacagaaccaactgcccttctctcacagttcg
tccagtataaacaagcactgggaggccgagctggcagccctgaagggcaacaatgccaag
ctgacagcagctctgctggagtccacagccaatgtcaaacagtggaaacaacaactggct
gcttaccaggaggaggctgagagactacatacacgtgtgacagagctggagtgtgtgagt
ggtcagatgaccgtcatcaaatcccagaagactgagctcaaccagacgatagaagaactg
gagtcggcattaaagtccaaggaggaggaactggagaggctgaaagaggaagtggagagc
gccaatgagttccagactcaaaaggaatcactaacacagaaactgcaggagacggaggag
aggaaccagacgttggaagctcagctggtggagttagagcagcgtctggagggcagtcag
ctggagagagaggccttcaggaagagtctgcgcaccctgctggagctgctagatgggaag
atctttgagctgacagagctccgagacagcctggccagactcattgagggcagcagcagc
tag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112242394
Entry
112242394         CDS       T05605                                 

Gene name
homer2
Definition
(RefSeq) homer protein homolog 2
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112242394 (homer2)
SSDB
Motif
Pfam: WH1 Macoilin DMPK_coil CENP-F_leu_zip MAD GAS TPR_MLP1_2 TSC22 FPP ATG16 Fez1 VGPC1_C Lebercilin FlaC_arch DUF3450 DHR10 Seryl_tRNA_N EzrA Crescentin
Other DBs
NCBI-GeneID: 112242394
NCBI-ProteinID: XP_024266093
LinkDB
Position
Unknown
AA seq 354 aa
MGEQPIFTTRAHVFQIDPTTKKNWVPASKQAVTVSYFYDSTRNSYRIISVDGSKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFASEQQLAKFAEKFQEVKEAAKLARDKSQEK
METSSNNSQESGRETPSSTQASSINGTDDEKISHGGPETAALMSENDKLKTTVEQSNTNA
KKLETELQTLRDSNARLVDALTESSANVEIWKKQLNTCKEESDTLREKIAELESQCEKAN
VEKERNSKLTVRVQELETELQDKEQELENLRKQAEIIPQLMAECESITEKLQAAEVKNKD
LEDRMEGLQVDIEDSQSRQGNMKGELKKFMDVLDGKIDELHEFRQGLSKLGLDN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggggagcagccaatcttcaccaccagggcccatgtgttccagattgacccgaccacc
aagaagaactgggtcccagccagcaaacaggcagtcaccgtttcctacttctacgactcc
acacgcaacagctaccgcatcatcagtgtagatggatccaaggtgatcatcaacagcacc
atcaccccaaacatgaccttcaccaagacctcccagaagtttggccaatgggctgacagc
agagccaacacagtgttcggactggggttcgcctccgagcagcagctggccaagtttgct
gagaagttccaggaagtgaaggaagcagcgaagctggccagggacaagtcacaggagaag
atggagacatcgagtaacaattcccaggagtcgggtcgtgagaccccctcgtccacccag
gcctccagcatcaacgggacggacgatgagaagatctcccacggaggaccggagaccgca
gcgctgatgagcgagaacgacaaactcaagaccactgtggaacagagtaacaccaatgct
aagaagttggagacagaactccagactctacgggacagtaatgctcggctggtagacgcg
ctaacggagtcctccgctaacgtagagatctggaagaaacaactcaacacctgcaaggag
gagagcgacacactgagggaaaagatagcagagttggagtctcagtgtgaaaaggccaac
gtggagaaggagaggaactctaagctgactgtacgagttcaggagctggagacggagctg
caggacaaggaacaggaactggagaacctgaggaagcaagcagagatcatccctcaactc
atggcagagtgtgagagcatcacagagaaactacaggctgctgaggtgaagaacaaggac
ctggaggataggatggagggtcttcaggtcgacatcgaggacagccagtccaggcagggc
aacatgaagggagagctgaagaagttcatggacgtcctggatgggaagattgatgagctg
cacgagttcaggcagggcctgtccaaactagggctggataactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244609
Entry
112244609         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 3-like isoform X1
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112244609
SSDB
Motif
Pfam: WH1 DHR10 Mod_r T3SSipB
Other DBs
NCBI-GeneID: 112244609
NCBI-ProteinID: XP_024268103
LinkDB
Position
Unknown
AA seq 364 aa
MYPQHREREQPIFSARAHVFQIDPNTKRNWIPASKHAVTVSFFYDGNRNVYRIISVGGTK
AIINCTITPSMTFTRTSQKFGQWADSRANTVYGLGFATEQQLHQFSERFKEVKEAARLAR
EKSQDKMELVNTALSIAAPQFSQDLGDELQSPPVMCVNGPEDKMFRSQSADITLSSEKER
IKKMLSEGSICEMNLEAELFTLQDSNSKLVSALHEANNNVQQWKKQLAAYQEETERLRDQ
VADLEAHGGHGPSDMLKDELTRSLEELEALLKAKDEEIHILQNKKSEYHEMEQEREEAIH
RLQEMEMRNLELERRVQNAEQNLAASLEERDRTESEVQRAIEILDIKLFDLNDLRQSLVK
LIDK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtatcctcaacatcgagaaagggagcagccaatcttcagtgccagggcccatgtgttc
cagatcgacccaaacaccaagaggaactggatccccgccagcaagcatgccgtcaccgtc
tccttcttctacgacggcaacaggaacgtgtaccgcatcatcagcgtgggtggtacgaag
gccatcatcaactgcaccatcacaccgagcatgacgttcaccaggacgtcgcagaagttc
ggccagtgggcggacagcagggccaacacggtctacggcctgggcttcgctacagagcag
cagctgcaccagttttctgagcggtttaaggaggtgaaagaggctgcccgtcttgcacgt
gaaaagtcccaggataagatggagttggtcaacactgctctcagcatcgctgccccacag
ttctcacaggacctcggtgacgagctccagtctccgccggtgatgtgtgtgaacggtcct
gaggacaagatgttccgcagccaaagcgcagacatcacactgtcttctgagaaggagcgt
attaaaaagatgctttcggaagggtctatctgcgagatgaacctggaggcagagctcttc
accctgcaggacagcaactccaagctggtgtcagcgttgcatgaagctaataacaacgtg
cagcagtggaagaagcagctagctgcctaccaggaggagacggagaggctacgagaccag
gtggctgatttggaagcacatggcggccacggtcctagtgacatgctaaaggacgagctg
actcggtctctggaggaactggaggccctgctcaaggctaaagacgaggaaatccacatt
ctgcagaacaagaaatcagaataccatgagatggagcaggagagagaagaagccatacat
agattacaggagatggagatgcgtaacctggagctggagcggcgggtgcagaatgccgag
cagaacctggccgcctccctggaggagcgggaccgcacagagagtgaggtgcagagggcc
atcgagatcctggacatcaagctctttgacctgaacgacctccggcagagccttgtcaag
ctgattgacaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248952
Entry
112248952         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 1-like isoform X1
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112248952
SSDB
Motif
Pfam: WH1 DASH_Duo1 BLOC1_2 DUF4407 DUF1664 GAS Crescentin Prominin CENP-K TMF_TATA_bd Atg14
Other DBs
NCBI-GeneID: 112248952
NCBI-ProteinID: XP_024274191
LinkDB
Position
4
AA seq 406 aa
MEGGSELVIRLPGRSHSPDNNGSSNFGLGEFGQTMVLRHKEVHHFFLAPFREQPIYSTRA
HAFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGTKAIINSTISPNMTFTKTS
QKFGQWADSRANTVYGLGFSTEHHLTKFAEKFSEYKEAARQAKGKSQDGKMELATSPSQE
SPAGELSSPLTPVTPPAMDNINGTDDPCDITPEPRPEPSQNALAFTHSPSINKHWEAELS
ALKGNNAKLTATLLESTANVKQWKQQLAAYQEEAERLHKRVTELECQNTQTPVIKSQKTE
LNQTIEELESTLKDKEEEMERLKEEVENANELLEQRHSLTQKLLETELHGRVLEEQLLGA
EQRLEESQEEQENFRKSLRTLLEMLDGKIFELTELRDSLAKLIEGS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggaaggcggtagcgagttggtgattcggttaccgggacgatcccattccccggacaac
aacggcagcagtaactttgggttaggcgagtttggccagacaatggtgttaaggcacaaa
gaggttcaccacttcttcttggcccccttcagggagcagccgatctacagcacgcgggcc
catgcgttccagattgaccccaacaccaagaagaactgggtgcccaccagtaaacacgct
gtcactgtgtcctacttctatgacagcacccgcaatgtttaccgcatcatcagcctcgac
ggcaccaaggcgataatcaacagcaccatcagccccaacatgaccttcacaaagacgtct
cagaagtttggccagtgggccgacagcagagctaatactgtttatggcttgggcttctct
actgaacaccacctgaccaagtttgcagagaagttttcagagtataaggaggcagcacgt
caggccaagggaaaaagtcaagatggaaagatggaactagccacctctccctctcaggag
tcgccagcaggtgaactctcttcacctctgactcctgtgactcctcccgccatggacaac
atcaacgggacagatgacccctgtgacatcacacccgaaccccgtcctgaaccgtctcag
aacgcactggctttcacacacagcccctccatcaataagcactgggaggcagagctatca
gctctaaaggggaacaatgctaagctaacagccactctgctggagtccacagctaacgta
aaacagtggaaacaacaactggctgcctaccaggaggaggccgagagactccacaaacgg
gtgactgagctagagtgccagaacacccagacccctgtgatcaaatcccagaagacggag
ctaaaccagaccattgaggaactggaaagcactctgaaggataaagaagaggaaatggag
cggttgaaagaggaagtggagaacgctaacgagctgctagagcagagacactccttgaca
cagaaactactggagacggagttgcatgggcgagtgttagaggagcagctcctgggagct
gagcagcgattggaagaaagtcaggaagagcaggagaacttcaggaagagcctaaggacc
ctactggagatgctggatgggaagatatttgagctgacagagctcagggacagcttggcc
aagctcatagagggcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250730
Entry
112250730         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 3-like isoform X1
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112250730
SSDB
Motif
Pfam: WH1 Crescentin Cep57_MT_bd T4SS CCDC-167 Spc7 Mod_r DUF1465 HAP1_N SlyX
Other DBs
NCBI-GeneID: 112250730
NCBI-ProteinID: XP_024276886
LinkDB
Position
5
AA seq 367 aa
MYPSHREREQPIFSARAHVFQIDPATKRNWLPASKHAVTVSFFYDANRSVYRIISVGGTK
AIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFATEQQLQQFSDQFKEVKEAARLAR
EKSQEKFELTNPALNIAAPQLSQDLSEDRHSPPLLTVNGPEDKLFRSKSADMEQLTSEKE
RIKKMLSEGSICEINLEAELFTLQDSNAKLVAALHEANTGVEEWKKQLAEYQEETGRLRD
QVAELEAQSGRPGPSESETRDELTQTLEELEALLKAKDEEIHNLQSKNSDIPDLEKEREE
AVQRLQDLETRNAELEQRVEKAEQTLASSLEERDRAESEVQRVIDVLDVKIYDLNDLRQS
LAKLIDK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtatccgtcacacagagaaagggaacaacccatcttcagtgccagagcgcacgtcttc
cagatagacccggccaccaagaggaactggcttccggccagcaagcatgccgtcactgtc
tccttcttctacgatgccaatcggagtgtgtaccgcatcatcagtgtggggggcaccaag
gccatcatcaacagcaccatcacccccaacatgaccttcaccaaaacctcccagaagttt
ggccagtgggctgacagccgcgccaacaccgtgtatggcctgggctttgccaccgagcaa
cagcttcagcagttttcagaccagttcaaggaagtgaaagaagcagcgcgtcttgcaagg
gagaaatcacaggagaaatttgaactgaccaaccctgcgctgaatattgccgccccacag
ctctctcaggacttatcagaggaccgccactcgccgccgctgctgactgtcaacggaccc
gaggacaagctgttccgcagcaagagcgccgacatggagcagctgacgtcggagaaggag
cgcattaagaagatgctgtctgaagggtccatatgtgagattaacctggaggcagagctg
ttcaccctgcaggatagcaacgctaagctagtggcggcgcttcacgaggctaacacgggc
gtggaagagtggaagaaacagctggctgagtatcaggaggagactggcaggctccgagat
caggtggcagagctggaggctcagagcgggcggcctggtcccagtgaatctgagacgagg
gatgagctgacccagacgttagaggagttggaagccttgctcaaagctaaagacgaggaa
atccacaatctacagagcaagaattcagatattcctgatttagagaaagagagggaagag
gcggttcagagacttcaggatctggagacacggaatgcagaacttgagcaacgggtggag
aaagccgagcagactctggcttcctctctggaggagcgggatagggcggagagtgaggtt
cagcgggtcatcgacgtcctggatgtcaagatctacgacctgaatgacctacgacagagc
ttggccaagctcatcgacaaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252119
Entry
112252119         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 3-like isoform X1
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252119
SSDB
Motif
Pfam: WH1 CENP-F_leu_zip Cep57_MT_bd T3SSipB Crescentin SlyX T4SS Spc7 TolA_bind_tri DUF3450 DUF1465 Mod_r Spc29
Other DBs
NCBI-GeneID: 112252119
NCBI-ProteinID: XP_024278850
LinkDB
Position
6
AA seq 367 aa
MYPSHREREQPIFSARAHVFQIDPATKRNWLPASKHAVTVSFFYDANRTVYRIISVGGTK
AFINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFATEQQLQQFSDQFKEVKEAARLAR
EKSQEKFELINPALNIAAPQISQELSEDRHSPPLLTVNGPEDKLFRSKSADMEQLTSEKE
RIKKMLSEGSICEINLEAELFTLQHSNAKLVAALHEANTGVVEWKKQLAEYQEETERLRD
QVAELEAQSGGPGPSGSETRDELTQSLEELEALLKAKDEIIHNLHSRKSDIHELEKEREE
AVQRLHDLETRNAELERRVESAEQTLASTLEEREQGQSEVQRVVDVLEVKIYDLNDLRQS
LAKLISK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtatccatcacacagagaaagggaacaacccatcttcagtgccagagcacacgtcttc
cagatagacccggccaccaagaggaactggctccctgccagcaagcatgcagtcaccgtc
tccttcttctacgatgccaaccggactgtgtatcgcatcatcagtgtggggggcaccaag
gccttcatcaacagcaccatcacccccaacatgacattcaccaaaacatcccagaagttt
ggccagtgggctgacagccgtgccaacaccgtgtacggactgggctttgccaccgagcaa
cagcttcagcagttttcagaccagttcaaggaagtgaaggaggcagcacgtcttgccagg
gagaaatcccaggagaaatttgaactgatcaaccctgcgctaaatatcgctgcccctcag
atctctcaggagctgtcagaggaccgccactcgccgccgctgctgactgtcaatgggcct
gaggacaagctgttccgcagcaagagcgccgacatggagcagctgacgtcagagaaggag
cgcataaagaagatgctgtctgaagggtccatatgtgagattaacctggaggcagagctg
ttcaccctgcagcatagcaacgctaagctagtggcggcgcttcacgaggctaacactggt
gtggtggagtggaagaaacagctggctgagtatcaggaagagactgagaggctccgagat
caggtggcagagctggaggctcagagtggagggcctggtcccagtgggtctgagacgagg
gatgagctgacccagtcattggaggagctggaagccttgctcaaagcaaaagacgagata
atccacaatctacatagcaggaaatcagatatccatgagttggagaaagagagagaagag
gctgttcagagacttcatgatctggagacacgaaacgcagaactggagcgacgggtggag
agcgccgagcagactctagcttccactctggaggagcgggaacaggggcagagtgaggtt
cagcgggtcgtcgacgtccttgaagtcaagatatacgacctgaatgacctgcgacagagc
ttggccaagctcatcagcaaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260318
Entry
112260318         CDS       T05605                                 

Definition
(RefSeq) homer protein homolog 3-like isoform X1
  KO
K15010  homer
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112260318
SSDB
Motif
Pfam: WH1 GAS Mod_r
Other DBs
NCBI-GeneID: 112260318
NCBI-ProteinID: XP_024291101
LinkDB
Position
10
AA seq 364 aa
MYPHHREREQPIFSARAHVFQIDPNTKRNWIPASKHAVTVSFFYDGNRNVYRIISVGGTK
AIINCTITPSMTFTRTSQKFGQWADSRANTVYGLGFATEQQLHQFSERFKEVKEAARLAR
EKSQDKMELANTALSIAAPQFSQDLSDELQSPPVMCVNGPEDKMFRSQSADITLSSEKER
IKKMLSEGSICEMNLEAELFTLQDSNSKLVAALHEANNNVEQWKKQLVAYQEETERLRDQ
VADLEAHGGHGPSDTLKDELTRSLEELEALLKAKDEEIHILQNKKEEYHEMEQEREEAIH
RLQEMEMRNLELERRVQNVEQNLSASLEERDRTESEVQRAIEILDVKIFDLNDLRQSLVK
LIDK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtatccacaccatcgagaaagggagcaaccgatcttcagcgccagggcccatgtgttc
cagatcgacccgaacaccaagaggaactggatccctgccagtaagcatgccgtcaccgtc
tccttcttctacgacggcaacaggaatgtgtaccgcatcatcagcgtgggcggtaccaag
gccattatcaactgcaccattacacccagcatgacgttcaccaggacctcgcagaagttt
ggccaatgggcggacagcagggccaacacggtctacggcctgggcttcgctacagagcag
cagctgcatcagttttctgagcggtttaaggaggtcaaagaggctgcccgtcttgcacgc
gaaaagtcccaggataagatggagttggccaacacagccctcagcattgctgccccacag
ttctcacaggacctcagcgatgagctccagtcgccgccggtgatgtgtgtgaacggtcct
gaggacaagatgttccggagccaaagcgcagatatcacactgtcttctgagaaggagcgc
attaaaaagatgctttctgaagggtctatctgcgagatgaacctggaggcagagctcttc
accctgcaggacagtaactccaagctggtggcggcgctacatgaagctaacaataacgtg
gagcagtggaagaagcagctagttgcctaccaggaggagaccgagaggctacgagaccag
gtggctgatctggaggcacatggcggacacggccctagtgacacgctcaaagacgagttg
actcgttctctggaggaactggaggccctgctcaaggctaaagatgaggaaatccacatt
ctgcagaacaagaaagaagaataccatgagatggagcaggagagagaagaggccatacac
cgattacaggagatggagatgcgtaacctggagctggagcggcgggtgcagaacgtggag
cagaacctgtccgcctccctggaggagcgggaccgcacggagagtgaagtgcagagggcc
atcgagatcctggacgtcaagatctttgacctgaacgaccttcggcagagcctggtcaag
ctcattgacaaatag

DBGET integrated database retrieval system