KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220384
Entry
112220384         CDS       T05605                                 

Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112220384
   04012 ErbB signaling pathway
    112220384
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220384
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112220384
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112220384
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112220384
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112220384
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 112220384
NCBI-ProteinID: XP_024238026
LinkDB
Position
20
AA seq 304 aa
MSSARFDPSDRSSWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPSMRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPNTAIGTSPIQTMGG
PEDNLEYVRTLYDFTGSDAEDLPFKKGEILIILEKPEEQWWSAKSKEGRMGMIPVPYVEK
LVRPSPHPGQPPHGSRNSNSYGIPEPAHAYAQPQTPSPLPPGTPGAVITPLPSMQNGPVM
AKAIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNGRRGLFPFTHVKIMDPQNP
DESE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcatctgcaaggttcgatccatcggaccggtccagttggtattttgggccggtgtca
agacaggaggcgcagaatagattacaaggacagaggcatggcatgtttttggttcgggat
tcttcaacctgccctggcgactatgtgctgtcagtatctgaaaattccaaagtgtcccac
tatatcatcaactccttaccaagcatgaggttcaaaattggagatcaagaatttgatcac
ctcccagcacttttggagttctataaaatccactacctggatacgactacactgatagaa
cctgcccccaggtacccaaacacagctataggcaccagccccattcagacgatgggcggc
ccagaagacaacctggagtatgtgcggactctgtacgacttcacgggcagcgatgctgag
gacctgccctttaagaagggggagatcctgatcatcctggagaagcctgaggagcagtgg
tggagtgccaagagcaaggagggccgcatgggcatgatccctgtgccctatgtggagaag
ctggtgcgaccctcccctcatcctggccagcctcctcacggctcccgcaactccaacagc
tatggcatccccgagccggcccacgcttacgctcagcctcagaccccttcgccccttccc
cctggcacccccggagcggtcatcacccccctgccctccatgcagaatgggcccgtcatg
gctaaggccatccagaaacgagtgccctgtgcctatgacaagacggccctggctctagag
gtgggtgatatagtcaaagtgacgaggatgaacatcagcggtcagtgggagggagaggtg
aatggccggaggggtctcttccccttcacccatgtcaaaataatggacccccagaatccg
gatgagagtgaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228388
Entry
112228388         CDS       T05605                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112228388
   04012 ErbB signaling pathway
    112228388
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228388
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112228388
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112228388
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112228388
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112228388
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 112228388
NCBI-ProteinID: XP_024249431
LinkDB
Position
30
AA seq 313 aa
MAGNFDAEDRASWYWGRLSRQEAVFLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGLAPPRFRIGDQEFDALPILLEFYKIHYLDTTTLIEPISKAKHTSFV
SCAATAPPTASGSAPQEAEFVRALFDFPGNDEEDLPFRKGDVLRVLEKPEEQWWNAANQE
CRAGMIPVPYVEKYRPASPTSVAGGPAGVGGCTTDGAAPQLPPPLGEPGQYAQPMVNTPL
PNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKHGHFPFTH
VRLLDHQHSEDES
NT seq 942 nt   +upstreamnt  +downstreamnt
atggccgggaattttgatgcggaggatcgtgctagctggtactggggaaggttgagccga
caggaggcggttttcctcttgcagggtcagagacatggcgtgtttctcgtcagggactct
attaccagtcccggggactacgtgctatccgtctcagagaactcaaaagtatcacattat
ataatcaacagcatcagcaacaaccggcaatctggatcaggtttggcccctccgcggttc
cgcatcggggaccaggagtttgacgccctgcccatccttctggagttctacaagatccac
tacctggacaccaccacgctgatcgagcccatcagcaaggccaagcacactagctttgtg
agctgtgccgccaccgcccctcccactgcatcgggcagcgccccgcaggaggcagagttt
gttcgcgccctcttcgacttccccggcaacgacgaggaggacctgcccttccgcaagggt
gacgtgctgcgtgtgctggagaagcctgaggagcagtggtggaacgcggctaaccaggag
tgccgcgccggcatgatccccgtaccctatgtggagaagtaccgacccgcctcgcccacc
tcggtggcgggagggccggcgggtgttgggggctgcactacagatggagcagcaccccag
ttgcccccgcctctgggagagccaggccagtatgcccagcccatggtcaacactcccctg
cccaacctgcagaacgggcccgtctatgcccgcgccattcagaaaagggtgcccaacgcc
tacgacaagacggccctcgccttggaggtcggagacatggtgaaagtgaccaagatcaac
gtgaacggccagtgggagggcgagtgcaagggcaagcacggccactttccctttacgcat
gtccggctgctggatcaccaacactccgaggacgagagctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230946
Entry
112230946         CDS       T05605                                 

Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112230946
   04012 ErbB signaling pathway
    112230946
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230946
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112230946
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230946
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112230946
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112230946
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 112230946
NCBI-ProteinID: XP_024253144
LinkDB
Position
33
AA seq 304 aa
MSSARFDSSDRSSWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPSKRFKIGDQEFEHLPALLEFYKIHYLDTTTLIEPAPRYPNTAIGTGPIQTMGG
LEDNLEYVRTLYDFTGSDTEDLPFKKGEILIILEKPEEQWWSAKSKEGRVGMIPVPYVEK
LVRPSPHPGQPPHSSRNSNSYGIPEPAHAYAQPQTPSPLPPGTPGAVITPLPSMQNGPVV
AKAIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNGRRGLFPFTHVKIIDPLNP
DECE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcatctgcacggtttgattcatcggaccggtccagttggtattttgggccggtgtcg
agacaggaggcgcagaatagattacaaggacagaggcatggcatgtttttggttcgggat
tcctctacctgccctggcgactatgtgctgtcagtatctgaaaactccaaagtgtcccac
tatatcatcaactccttgccaagcaagaggttcaagatcggtgaccaagaattcgagcac
ctcccagctcttttggaattctacaaaatccactacctggatacgactacactgatagaa
cctgcccccaggtaccctaacacagcgataggcaccggacccattcagacgatggggggt
ctagaggacaacctggagtacgtgcgaactctgtacgacttcacgggcagcgacactgag
gacctgcccttcaaaaagggtgagatcctgatcatcctggagaagcctgaggagcagtgg
tggagcgccaagagcaaggagggccgagtgggcatgatccctgtgccctatgtggaaaag
ctggtgcgaccctcccctcaccctggccagccccctcacagctcccgcaactccaacagc
tatggcatcccagagccggcccacgcttacgcccagcctcagacgccctcgcccctgcct
cctggcacccctggagcagtcatcacccccctaccctccatgcagaacgggccagtcgtg
gctaaggccattcagaaacgagtaccctgtgcatatgacaagactgccctggctctagag
gtgggtgatatagtcaaagtgacgaggatgaacatcagcggtcagtgggagggagaggta
aacggccggagaggtctcttccccttcacccacgtcaaaataatagaccccctgaatcca
gatgagtgtgaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258044
Entry
112258044         CDS       T05605                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112258044
   04012 ErbB signaling pathway
    112258044
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258044
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258044
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112258044
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112258044
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112258044
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 112258044
NCBI-ProteinID: XP_024287875
LinkDB
Position
9
AA seq 321 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKAKHAGFV
SCAAAASGGALQEAEFVRALFDFPGNDEEDLPFRKGDVLRVLEKPEEQWWNAANQEGRVG
MIPVPYVEKYRPASPNSLVAPVAGRPGGGVGGVPAGVGASTTDGAAPQLPPPLGEPGQYA
QPVGNTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGK
HGHFPFTHVRLLDHQHPEDES
NT seq 966 nt   +upstreamnt  +downstreamnt
atggccgggaattttgatgccgaggaccgtgctagctggtactggggaaggttgagccga
caggaggcggtttctctcttacagggtcagagacatggcgtgttcctagtcagggactcg
attaccagtcctggggactacgtgctatccgtctcagaaaactcaaaagtctcacattat
ataattaacagcatcagcaacaaccggcaatctggatcaggtctggcccccccacggttc
cgcatcggggatcaggagtttgacgcccttcccgccctgctggagttctacaagatccac
tacctggacaccaccactctgatcgagcccatcagcaaggccaagcatgcaggcttcgtg
agctgtgccgctgctgcatcaggcggcgccctacaggaggcagagtttgttcgcgccctc
ttcgacttccctggcaacgacgaggaggacctgcccttccgcaagggtgacgtgctgcgc
gtgctggagaagcctgaggagcagtggtggaacgcggccaaccaagagggccgtgtcggc
atgattcccgtgccctacgtggagaagtaccggcctgcctcgcccaactccttggtggct
ccggtggcagggaggcctggcggaggagtaggcggagtaccggcaggtgttggagccagc
actaccgacggagcagctccccagctgcccccgcctctgggggagccgggccagtatgcc
cagcctgtgggcaatacacccctgcccaacctgcagaatgggcctgtctacgcccgtgcc
attcagaagagggtgcccaacgcctacgacaagacggccctcgccttggaggtcggagac
atggtaaaagtgaccaagatcaacgtgaacggccagtgggagggcgagtgcaagggcaag
catggccactttcccttcacgcacgtccggcttctggaccaccaacaccctgaggatgag
agctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258186
Entry
112258186         CDS       T05605                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112258186
   04012 ErbB signaling pathway
    112258186
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258186
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258186
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112258186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112258186
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112258186
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 112258186
NCBI-ProteinID: XP_024288142
LinkDB
Position
9
AA seq 321 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKAKHAGFV
SCAAAASGGALQEAEFVRALFDFPGNDEEDLPFRKGDVLRVLEKPEEQWWNAANQEGRVG
MIPVPYVEKYRPASPNSLVAPVAGRPGGGVGGVPAGVGASTTDGAAPQLPPPLGEPGQYA
QPVGNTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGK
HGHFPFTHVRLLDHQHPEDES
NT seq 966 nt   +upstreamnt  +downstreamnt
atggccgggaattttgatgccgaggaccgtgctagctggtactggggaaggttgagccga
caggaggcggtttctctcttacagggtcagagacatggcgtgttcctagtcagggactcg
attaccagtcctggggactacgtgctatccgtctcagaaaactcaaaagtctcacattat
ataattaacagcatcagcaacaaccggcaatctggatcaggtctggcccccccacggttc
cgcatcggggatcaggagtttgacgcccttcccgccctgctggagttctacaagatccac
tacctggacaccaccactctgatcgagcccatcagcaaggccaagcatgcaggcttcgtg
agctgtgccgctgctgcatcaggcggcgccctacaggaggcagagtttgttcgcgccctc
ttcgacttccctggcaacgacgaggaggacctgcccttccgcaagggtgacgtgctgcgc
gtgctggagaagcctgaggagcagtggtggaacgcggccaaccaagagggccgtgtcggc
atgattcccgtgccctacgtggagaagtaccggcctgcctcgcccaactccttggtggct
ccggtggcagggaggcctggcggaggagtaggcggagtaccggcaggtgttggagccagc
actaccgacggagcagctccccagctgcccccgcctctgggggagccgggccagtatgcc
cagcctgtgggcaatacacccctgcccaacctgcagaatgggcctgtctacgcccgtgcc
attcagaagagggtgcccaacgcctacgacaagacggccctcgccttggaggtcggagac
atggtaaaagtgaccaagatcaacgtgaacggccagtgggagggcgagtgcaagggcaag
catggccactttcccttcacgcacgtccggcttctggaccaccaacaccctgaggatgag
agctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265169
Entry
112265169         CDS       T05605                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265169
   04012 ErbB signaling pathway
    112265169
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265169
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265169
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112265169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112265169
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112265169
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 112265169
NCBI-ProteinID: XP_024298022
LinkDB
Position
13
AA seq 308 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGQAPPRFRIGDQEFDALHSLLEFYKIHYLDTTTLIEPINKAKHSPLV
SVNAGAGGPPQRQEDEMVRALFDFPGNDDEDLPFKKGDILRVLEKPEEQWWNAKNLEGRA
GMIPVPYVEKYRPASPTSGGLGTGGPGGVGSVDGSSVQGPPLLDPSQYAQPTPLPNLQNG
PVFARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKRGHFPFTHVKLLDH
NNPEDDVS
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccggaaattttgacgcagaggatcgtgcaagttggtactggggaagattaagtaga
caggaggcagtttcacttttacaaggacagagacacggagtgtttttggtgagagactcc
attacaagccctggcgactacgtcctgtctgtttcagagaattccaaagtctcgcattac
ataatcaacagcatcagcaacaaccggcagtctggctcaggccaggcgcctccacggttc
cgcataggggaccaggagtttgacgccctccactccctgctggagttctacaagatccac
tacctggacaccaccactctgatagagcccatcaacaaggccaaacactctcccttggtc
agcgtcaacgcaggtgctggaggcccgccgcagcggcaggaagacgagatggtccgtgcc
ctcttcgacttcccaggcaacgacgatgaagatctgcctttcaaaaagggcgacatcctg
cgggtcctggagaagcctgaggagcagtggtggaacgccaagaatttagaggggcgtgcc
gggatgatccctgtgccctacgtggagaagtaccgaccggcctctcccacctcggggggc
cttggaacagggggtccaggtggggtgggctcggtagacggctccagtgttcagggccct
cctctgctagacccgagccaatacgcccagcccacacctctgcccaacctgcagaacgga
cccgtctttgccagggccatccagaagagggtgcccaatgcctacgacaagaccgccctt
gccttagaggtgggtgacatggtgaaggtgacaaagatcaatgtgaacggccagtgggag
ggcgagtgcaagggcaaacgaggccacttccccttcacacatgttaagctgctggaccat
aataacccggaggacgacgtgagctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266812
Entry
112266812         CDS       T05605                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112266812
   04012 ErbB signaling pathway
    112266812
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266812
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112266812
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112266812
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112266812
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   112266812
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 112266812
NCBI-ProteinID: XP_024300412
LinkDB
Position
14
AA seq 306 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGAGQAPPQFRIGDQEFDALHSLLEFYKIHYLDTTTLIEPINKAKHSFLV
SAGAGGPPQRLENEYVRAVFDFPGNDDEDLPFRKGDILRVLEKPEEQWWNAQNLEGRAGM
IPVPYVEKYRPASPTSGGPGAGGPGGVGSVDGSSVQGPPLLDPSQYAQPTPLPNLQNGPV
FARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKRGHFPFTHVKLLDHNN
PEDEVS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggccggaaattttgacgcagaggaccgtgcaagttggtactggggtagattaagtaga
caggaggcagtttcacttttacaaggacagagacacggagtgtttttggtgagagactca
attacaagtccaggcgactacgtgctgtcagtttcagagaattccaaagtctcgcattac
ataatcaacagcatcagcaacaaccggcagtctggcgcaggccaggcgcctccgcagttc
cgcataggggaccaggagtttgacgccctccactcgctgctggagttctacaagatccac
tacttggacaccaccactctgatagagcccatcaacaaggccaaacactctttcttggtc
agcgcaggtgctggcggcccgccgcagcggctggagaacgagtatgtccgtgccgtcttt
gatttcccaggcaacgacgatgaggaccttcctttcagaaagggcgacatcctgcgggtt
ctggagaagcctgaggagcagtggtggaatgctcagaatttagaggggcgtgccgggatg
atccctgtgccctacgtggagaagtaccgaccggcctctcccacctcggggggccctgga
gcagggggtcccggtggggtgggctctgtagatggctccagtgttcagggccctcctctg
ctagacccgagccagtacgcccagcccacacctctgcccaacctgcagaacggacccgtc
tttgccagggccatccagaagagggtgcccaatgcctacgacaagaccgcccttgcctta
gaggtgggcgacatggtgaaggtgacaaagatcaacgtgaacggccagtgggagggcgag
tgtaagggcaagcgtggccacttccccttcacccacgttaagctgctggaccataataac
ccagaggacgaggtgagctga

DBGET integrated database retrieval system