KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220399
Entry
112220399         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta-like isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112220399
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112220399
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112220399
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220399
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112220399
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112220399
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112220399
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112220399
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112220399
 Endosome - Golgi transport
  Others
   Others
    112220399
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112220399
NCBI-ProteinID: XP_024238046
LinkDB
Position
20
AA seq 509 aa
MATTTTESGGTSGSKDYKKPTAAALKGAIQLGIGYAVGNLTSKPDRDVLMQDFYMVESVF
LPSEGSNMTPAHHFPDFRLKTYAPLAFRYFRELFGIKADDYLYSICNEPLIELSNPGASS
SWFYLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCIQCAGVNIR
LVVMNNVLPRALKMHYKYDLKGSTYKRHASRKERAKSSPTFKDLDFQEMLEGLHFDGDTY
SALMKTLQRDCRVLESFKIMDYSLLLGVHVLDKSLERGARGDSKRLNSQRVLYSTALESI
QGEGDGKVAEPVADDNTMGGIPAKHKDEKLLIFLGIIDILQSYRLIKKMEHSWKALVHDG
DTVSVHRPGFYADRFLNFMGGTVFKKIHPLRGASSKRKRSSIHAMRSASQEVLSPQKEEK
DERKAQSMECLDRPLSSSKHPDLVTLPKNIKQAVSFSSSALQTIKKDLEEHLENSASCMT
VALDDTVPFPPTQGSPDSVHDVYLTGGRR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcaacaacaaccactgaaagtggaggaaccagtgggtcaaaagattacaaaaagccc
acagcggctgccctgaaaggagccatccagctgggcattgggtacgcagtggggaacctg
acatccaagcctgacagagatgtactcatgcaggacttctacatggtggagagtgtcttc
ctacccagtgaggggagcaacatgacaccagcgcaccacttcccagacttccgtctcaaa
acctacgcccctctcgccttccgctacttccgagagctctttggcatcaaagcagatgac
tacctgtactccatctgtaacgaacctctgattgagctgtccaaccctggggccagcagt
tcctggttctacctgaccagcgacgatgagttcatcattaagactgtgcagcataaagaa
gctgaattcctgcagaaactccttcctggttactacatgaatctgaatcagaacccgagg
acactgctacctaagttctatggcctttactgcatccagtgtgccggggtcaacatccgt
ctggtggtgatgaacaacgtgttgcccagggcccttaagatgcactacaaatatgacctg
aaaggctccacctacaaacgacacgcctcgcgcaaggagcgcgccaagtcctcgcccact
ttcaaggacctggacttccaggagatgctcgagggcctgcactttgatggcgacacgtac
agtgccttgatgaagactctgcagagggattgcagggtcctggagagctttaagatcatg
gactacagtctcctgctaggggtgcatgttctggacaagagtctggaaaggggggccagg
ggggacagtaagcgcctcaacagccagagggtcctctactccactgccctggagtccatc
caaggggaaggcgatggcaaggttgcagagccagtggcagacgataacacaatgggtgga
attccagcaaaacacaaagatgagaagctgctgatcttcttggggatcattgatatccta
cagtcctacaggttaattaagaagatggagcactcctggaaggcccttgtacacgatggg
gacaccgtgtcagttcacaggcccggtttctatgcagacagatttcttaatttcatgggt
ggcactgtattcaaaaagatccatcctctaagaggagcatcctctaagaggaagaggagc
tccatccatgcgatgaggtcagcctcccaagaggtgctgtccccccaaaaggaggagaag
gatgagaggaaggcccaaagcatggagtgcctggacagaccattaagttcctccaagcac
cctgacctagtcacgctccctaaaaatataaagcaggctgtttccttctcctcctccgct
cttcagactatcaagaaagaccttgaggagcacctggagaatagtgcctcttgtatgact
gtggccctggatgacactgtcccctttccccctacccagggcagcccagactctgtacat
gatgtctacttgactggtggcagaagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227340
Entry
112227340         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta-like
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112227340
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112227340
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112227340
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227340
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112227340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112227340
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112227340
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112227340
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112227340
 Endosome - Golgi transport
  Others
   Others
    112227340
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112227340
NCBI-ProteinID: XP_024247993
LinkDB
Position
28
AA seq 668 aa
MHCVLSCCLLWSSTEDVVLGGLQYKRDAVPHSSGSRPRSGEEIGHRRVDALEDHLQEYDA
PALSCLSLFLAPNPIFSPSSHREGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDY
LYSLCNEPLIELSNPGASGSIFYVTRDDEFIIKTVNAKEAEFLQKLLPGYYMNLNQNPRT
LLPKFFGLYCVQSGGKNIRIVVMNNVLPRAVRMHLKFDLKGSTYKRRASKKEREKSNPTF
KDLDFIADVPEGLTLDQDTYSALLKTLQRDCLVLESFKIMDYSLLLGVHNLGLAVRESQG
SPAGGDEKKPQAQRALYSTAMESIQGGKACRDTLDHDATMGGIPAVDGKGERLLLFIGII
DILQSYRLIKKLEHSWKSLISDGDTVSVHRPSFYADRFYKFCSTTVFRKSCSLRSSPSKR
GRGGALPAPKNSVQTQLSVEREENQENEDLHLRGARGFPLLEEDGLREHPHTPPSFEDAT
TASIATTLSSNNSLPTTPFDTPEHPRFRRPTHSPRDRDGSFRPQQEVVAVHEQTITVAVE
VKREPTTSVVPEDLQDSKATEEEVITQTTAASPTSSTPPSTPPPSSAPPSSTTPCSVPLA
STLPRSLPPSVPSSSAPHPHSNSTLPSSSTRPFSTNQSSAHIASNPFHLCSPSSLQRPLP
PLPPPPFP
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgcattgtgttctctcctgctgtcttctctggtcttcaacagaagacgtggtcctagga
gggctacaatacaagcgagatgccgtcccccacagctcagggtctaggcccaggtcagga
gaagagattggccacaggagagtagacgctctggaggaccacctacaagagtacgatgcc
cccgctctctcctgtctttctctctttctggctcccaaccccatattctctccctcttct
caccgtgagggtagtaacctgactcctgcacatcactacccagacttcaggtttaagacc
tacgccccagtggccttccgctacttcagagagctgtttgggatccgacccgatgactac
ctgtactctctatgtaatgagcccctaatcgagctgtccaatcccggtgccagcggctcc
atattctacgtaaccagggacgacgagttcatcatcaaaacagtcaatgccaaggaggcg
gagtttctgcagaaactacttccgggatactacatgaatctgaatcagaacccgaggacc
ctgcttcctaagttctttggtctctactgcgtccagtctgggggtaaaaacatccgtatc
gtggtcatgaacaatgtgttaccgcgcgccgtacgcatgcacctcaagtttgacctgaag
ggctccacgtataaacggcgtgcgtcgaagaaagagagggagaaatcgaatcccaccttt
aaagatctggactttatagcagatgtaccggaaggactgaccctggatcaggatacatac
agcgccctgctaaagaccctacagagagactgtctggtgctcgagagctttaagatcatg
gactacagtctactgctgggggtccataacctgggcctggctgtgagagagtcccagggc
tcaccagcagggggcgatgaaaagaagcctcaggcccagagagccctctattctactgcc
atggagtctatacagggagggaaggcttgtagagacacattagaccacgatgctacgatg
ggtggtattcctgctgtggatggtaaaggagagcgtctccttctctttattggaattatc
gacatcctgcagtcctacaggctaatcaagaaactggagcactcgtggaagtctctgatc
agtgacggggacacagtgtctgtccacaggcccagtttctatgcagacaggttctacaag
ttctgcagcaccactgtctttagaaagagctgctccctgaggtcttctccctccaagaga
gggcgggggggggctctgcccgcacccaaaaacagtgtccaaacacagctttccgtagag
agagaggagaaccaggagaacgaagacctgcacctcagaggggctcgtggcttccctctg
ctggaggaggacggtctgagagagcatccccacactcctccgtcttttgaggatgcgacc
acagcatccatcgctaccacgctctcttcaaacaactctctccctaccacaccctttgat
acaccagaacacccacgcttcaggaggccaacccactctccacgggaccgtgacgggagt
ttcaggccacagcaggaagtagtggcggtgcacgagcagaccatcactgtagctgtagag
gtgaagagggaacctacaaccagtgtggttccagaggaccttcaggactctaaagcaaca
gaggaggaagtcatcacacagaccacagctgcttccccaacttcctctacacctccttca
acccctcctccctcctccgcccctccatcctccactactccctgctcagtcccactagcc
tccactctccctcgctcccttcctccctcagtcccttcctcttctgcccctcaccctcac
tctaactccactctcccttcttcttccactcgtcctttctccaccaatcaatcatcagct
cacatcgcctccaaccccttccacctctgcagtccctccagcctccaacgccctcttcca
ccactcccgcctccacccttcccc

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230514
Entry
112230514         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta-like
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112230514
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112230514
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112230514
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230514
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112230514
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112230514
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112230514
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112230514
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112230514
 Endosome - Golgi transport
  Others
   Others
    112230514
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112230514
NCBI-ProteinID: XP_024252566
LinkDB
Position
33
AA seq 523 aa
METTTTENGGGGTSGSKDYKKPTAAALKGAIQLGIGYAVGNLISKPDRDVLMQDFYMVES
VFLPSEGSNMTPAHHFPDFRLKTYAPLAFRYFRELFGIKADDYLYSICNEPLIELSNPGA
SSSWFYLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCIQCAGVN
IRLVVMNNVLPRALQMHYKYDLKGSTYKRHASCKERAKFSPTFKDLDFQEMLEGLHFDGD
TYSALMKTLQRDCRVLESFKIMDYSLLLGVHVQDKKCLDRGARADSKRLNGQRVLYSTAL
ESIQGDGDGKVAEPVADDDTMGGIPAKHKDEKLLIFLGIIDILQSYRFIKKVEHSWKALV
HDGDTVSVHRPGFYADRFLKFMGGTVFKNIRPLRGASSKRKRSSIHAMRSASQEVLSPQK
EEKKDERNAQSMESLGGQLMSSSKHPDLVLLPKCLNQAVSSSFSTLEKIKKDLEEHLEEH
LENSDNHCDSSANVALDDTVPSPHTQGSPDSTQCLLVKTCGRR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggaaacaacaaccactgagaatggaggtggaggaaccagtgggtcaaaagattacaaa
aagccaactgctgctgcactgaaaggagccatccagctgggcattgggtatgctgtgggg
aacctgatatccaagcctgacagagatgtgctcatgcaggatttctacatggtggagagt
gtctttctacccagtgaggggagcaacatgaccccagcgcaccacttcccagacttccgc
ctcaaaacctacgcccctctcgccttccgctactttagggagctctttggcatcaaagca
gatgactacctgtactccatctgtaatgagcctctgatcgagctgtccaaccccggggcc
agcagttcctggttctacctgaccagcgacgatgagttcatcattaagacagtgcagcat
aaagaggctgagttcctgcagaaactccttcctggttactacatgaatctgaatcagaac
ccgaggacactgctacctaagttctacggcctgtactgcatccagtgtgccggggtcaac
atccgtctggtggtgatgaacaacgtgttgcccagggccctccagatgcactacaaatac
gacctgaagggctccacctacaaacgccacgcctcgtgcaaggaacgcgccaagttctca
ccgaccttcaaagacctggacttccaggagatgcttgagggcctgcactttgatggtgac
acgtacagtgccttaatgaagacattgcagagggactgcagggtcctggagagctttaag
atcatggactacagcctcctgctgggggtgcatgtgcaggacaagaaatgtctggacagg
ggggccagggcggacagtaagcgcctcaatggccagagggtcctctactccaccgccctg
gagtccatccaaggggatggggatggcaaggttgcagagccagtggccgacgatgacaca
atgggtggaattccagctaaacacaaagatgagaagctgctgatcttcttagggatcatt
gacatcctccagtcctaccggttcatcaagaaggtggagcactcctggaaagccctcgta
cacgatggggatacagtgtcagttcacaggcccggtttctatgcagacagatttttgaag
tttatgggcggcactgtattcaaaaatatccgtcctctaagaggagcatcctccaagagg
aagaggagctccatccatgcgatgaggtcagcctcccaggaggtactgtccccccaaaag
gaggagaagaaggacgagagaaacgcccaaagcatggagagcctgggcggacaattaatg
agttcctccaagcaccctgacctagtcctacttccgaaatgtttaaatcaggctgtttcc
tcatccttctccactcttgagaagatcaagaaagaccttgaggagcaccttgaggagcac
ctggagaatagtgataaccattgtgactccagtgcaaatgtggccctggatgacacagtc
ccctctccccatacccagggcagcccagactctacgcaatgtctacttgtgaagacgtgt
ggaagaagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235372
Entry
112235372         CDS       T05605                                 

Definition
(RefSeq) putative PIP5K1A and PSMD4-like protein
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112235372
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112235372
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112235372
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112235372
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112235372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112235372
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112235372
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112235372
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112235372
 Endosome - Golgi transport
  Others
   Others
    112235372
SSDB
Motif
Pfam: PIP5K VWA_2 Ssl1 UIM VWA RAP80_UIM
Other DBs
NCBI-GeneID: 112235372
NCBI-ProteinID: XP_024259581
LinkDB
Position
Unknown
AA seq 991 aa
MATAVPVDSGLTAPTDIRTQFWRRALQRGSSASRKVASPEIPGSSQSMKKTIGHRGVETN
TGETTYKKTTSSALKGAIQLGITHTVGSLSQKAERDVLMQDFVVVESIFFPSEGSNLTPA
HHYSDFRFKTYAPIAFRYFRELFGIRPDDYLYSLCNDGLIELSNSGASGSLFYVSSDDEF
IIKTVQHKEAEFLQKLLPGYFMNLNQNKRTLLPKFYGLYCIQAGGKNIRLVVMNNLLPRV
VHMHHKYDMKGSTYKRRASAKERDKTFPTFKDLDFIQDLPDGLLLETDNYNALSKTIQRD
CLLLQSFKIMDYSLLVGIHNLEQASRERERGGRQMGDSGGSEGAVTPDQRRPQAQKSLYC
TAMESIQGEARGKGALESEDHMGGIPARNSKGERLLVFIGIIDILQSYRFIKKLEHSWKA
LVHDGDTVSVHRPGFYAERFQQFMCNTVFKKIPLKLSPSKKSRGGVPGGLRRAPTLGGPT
PLSHAAGQSVVDSRLVYQSHFNKADAEGDSGMQSGRPDLVPRTPPLAGGSGDAEANFSTS
SLGSTGLTXSSPLLQSVGVEVHRAVTSTDQDHGVSHSMGAEVEASGDQSGNEDAISLSDI
IPETNICFQQEDSKMGLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPE
NNVGLITMANNCEVLTTLTADAGRILSKLHAVQPRGNISFCTGIRVAHLALKHRQGKNHK
MRIIAFVGSPVEDNEKDLVKMAKRLKKEKVSVDIINFGEEEVNTEKLTAFINTLNGKEGA
GSHLVTVPPGPSLADALLSSPILAGEGGAMLGLGSSDFEFGVDPSADPELALALRVSMEE
QRQRQEDETRRAAVVSAXEAGVPSPTADESDEALLKMSVPQADTATPAMPDFSRMTEDEQ
IAYALQMSMQGGEFGAESMDMDTGAPVDSEGAKDEEDYDVMQDPEFLQSVLENLPGVDPN
NEAIRNAMGSLASQTGSKPDSKKDKDDXKKK
NT seq 2976 nt   +upstreamnt  +downstreamnt
atggcgaccgccgttccagttgattcgggattgactgctccgacagacattaggactcag
ttctggaggagagccttgcagagagggtccagtgcgtctcggaaagtggcatctccagag
attcctggatccagtcagagtatgaagaagaccattggacacagaggagttgagacgaac
actggagagaccacctataagaagaccacgtcgtcagccctgaaaggagcaattcagctg
ggcatcactcacactgtgggcagcctgagtcagaaggctgagagggatgttctcatgcag
gactttgtggtggtcgagagcatcttcttccccagtgagggcagtaacctgacccctgcc
caccattacagtgatttccggtttaagacctacgcccccatcgccttccgctacttcaga
gaactatttggcatccggccagacgactacctgtactctctgtgtaacgatggcctgata
gagctgtctaactccggcgccagcggctctctcttctacgtgtccagtgatgatgagttc
attatcaagacggtgcagcacaaagaggctgagtttctccagaagctactgccaggatac
ttcatgaatctgaatcagaacaaacggaccctgctccctaagttctacggtctgtactgc
atccaggcgggagggaagaacatccgcctggtggtgatgaacaacctgctgccccgcgtg
gtccacatgcaccataagtacgacatgaagggttccacctataagagacgggcctcagcc
aaggagagggacaagacttttcccacctttaaagacctggacttcatccaggacctgcct
gatggactactgctggagacggacaactacaacgcccttagcaagaccatccagagagac
tgcctgctcctgcagagttttaaaatcatggactacagtctactggtggggatccataac
ctggagcaggctagtagagagagggagcgaggtgggaggcagatgggggacagtgggggg
tcagagggggcagtaaccccagaccagcgccgaccccaggcccagaaaagtctttactgc
acagccatggagtctatacagggagaggcccgcgggaagggagccctggagtctgaggac
catatgggcgggatcccagccaggaactctaaaggagagaggttgctggtctttatcggc
atcatcgacattctgcagtcctacaggttcatcaagaagttggaacactcrtggaaggcc
ctcgtccatgatggggatacagtgtcggtgcacagaccaggcttctacgctgagcgcttc
caacaattcatgtgtaacacagtgttcaagaagatcccattgaagctctccccatccaag
aaatctcgtggtggggttccggggggtctgaggagagctcctaccctgggaggccccacc
ccactctcccacgctgctggacagtctgtggtggactcycgactcgtctaccaatcacac
ttcaacaaggctgatgcagagggagacagtggcatgcagtcgggcaggccagacctggtg
ccaaggacccctcccctggcgggagggtcaggggatgcggaggccaacttttccacatcc
tcattaggaagcacaggactcaccwcctcctctcctctgctacagtcagtaggggttgag
gtacatagagcagtaacaagcacagaccaagaccacggtgtctcccacagtatgggtgcg
gaagtggaagcgtcaggtgatcagtcgggtaatgaagatgccatctcactatcagacatt
atcccagagactaacatctgctttcaacaagaagattccaagatggggctcgaaagtact
atggtctgtgtggacaacagtgagtatatgaggaatggagacttcctccccaccagactt
caggcccagcaagatgctgtcaacattgtgtgccactccaagacgcgcagcaaccctgag
aacaaygtgggcctcatcaccatggccaataactgtgaggtgctgaccacmttgactgca
gacgcggggaggatactgtctaaactgcacgctgtccagccccgtggaaacatcagcttc
tgcacaggcatcagagtggctcatttggctctgaagcacagacaggggaagaaccacaag
atgcgtataattgcctttgtgggcagcccagtggaggacaaygagaaggatctggtgaaa
atggcaaagcgtctaaagaaagagaaagtcagtgtggacatcattaactttggagaggag
gaggtgaacacagaaaagctgacggccttcatcaacactctgaatgggaaggaaggagca
gggtcccaccttgtgacagtgcctccaggccccagtctggctgatgccctrctgtcctct
cctatccttgctggggagggaggagccatgctgggcctggggtccagtgactttgagttt
ggagtggaccccagtgcagacccagagctggcactggctttgagggtgtctatggaggag
cagagacagaggcaggaggatgagactcgcagggcagcagtggtgtctgctrctgaggcc
ggggttccctcgcctaccgctgacgagtcagacgaagctctgctgaagatgtcagtcccc
caggctgacacggccacgcccgctatgcccgacttcagccgcatgacggaggacgagcag
attgcctacgcyctacagatgtccatgcagggtggagagtttggtgcagagtcaatggac
atggacacaggagcccctgtagactcagagggtgctaaggatgaggaggactatgatgtg
atgcaggacccagagttcctccaragcgtcctggagaacctaccgggtgtcgaccccaac
aacgaggccatccggaatgccatgggctcgctggcctcacagacaggatccaaacctgac
agcaagaaagacaaagacgatgakaagaagaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248588
Entry
112248588         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta-like
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112248588
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112248588
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112248588
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112248588
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112248588
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112248588
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112248588
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112248588
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112248588
 Endosome - Golgi transport
  Others
   Others
    112248588
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112248588
NCBI-ProteinID: XP_024273506
LinkDB
Position
4
AA seq 531 aa
MSTTTENGVGGSRNTSGEKTYKKTTSSALKGAIQLGIGYTVGNLTSKPDRDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICNEPLIELSNP
GASGSLFYLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCIQSGG
VNIRLVVMNNVLPRSVKMHYKYDLKGSTYKRRASRKEREKACPVYKDLDFQDMHEGLYFD
ADTYNALMKTLQRDCRVLESFKIMDYSLLLAVHVLDQSPKEGGEPGQAGGDGKRPVAQRV
LYSTAMESIQGDGKAAEAHTTDDTMGGIPAKSHKEEKLLIFLGIIDILQSYRFIKKLEHS
WKALVYDGDSVSVHRPGFYANRFLKFMSTSVFRKTQTIRFSPSKRARTSIPALKSFSQEI
LSSQKEENEEESRDRLGGARSLASLDGQVFGSYLRPDLVPDTPSFYEGSSMGTISSIFVK
LETQSEDRDDMASSSTFTLEDSAICLTSEQSTMDVEVDMDQDDGSVLDVYL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtcaacgaccacagaaaatggagtgggagggtctcgaaacacgagcggagagaaaaca
tacaagaagaccacatcgtcagccctgaagggggccatccagttgggcatcggctacaca
gtgggcaacctgacctccaaacctgacagagatgttctcatgcaggacttctatgtggtg
gagagcgtcttcctgccaagcgaggggagcaacctgacaccggctcaccactacccagac
ttccgcttcaaaacctacgccccgctggccttccgctacttccgggagctcttcgggatc
aaaccagatgactacctgtactccatctgtaatgagcctctgattgagctgtccaacccc
ggggccagcggctctctgttctacctgaccagcgatgacgagttcatcatcaaaaccgtc
cagcacaaagaggctgagtttctccagaaacttctcccaggttactacatgaacctgaac
cagaacccacgcaccctgctgcctaagttctacggcctgtactgcatccagtctggaggc
gtcaacatccggctggtggtgatgaacaacgtgctgccgcgctccgtcaagatgcactac
aagtacgacctgaagggctccacctacaagagacgtgcctccaggaaggagagggagaag
gcctgtcccgtctacaaggacctggacttccaggacatgcatgaagggctctacttcgac
gctgacacctacaatgccttgatgaagaccctgcagagagactgccgggtattggagagc
tttaagatcatggattacagtctgctccttgccgtgcatgtcctggaccagagcccaaag
gaggggggcgagccgggccaggcagggggggacggcaagaggcccgtggcccagagggtc
ctctactccacagccatggagtctatccaaggggacggcaaggctgccgaggcccacacc
acagacgacacgatgggtggaattcctgccaaatcacacaaagaagagaagctgcttatt
ttcctgggtatcatcgacatcctgcaatcctaccgattcattaagaagttggagcactcg
tggaaagccctggtctacgacggcgactctgtctcagtgcacaggcccggtttctatgcc
aaccgattcctcaagttcatgagcacttcggtgttccggaagactcagaccattcggttc
tccccttctaagagagcgcgtacgtccatccctgctctgaagtcgttctctcaggaaatc
ctgtcttctcagaaggaggagaacgaggaggagagtcgggacaggctgggaggagcacgc
agtctggccagtctagacggacaagtgtttggctcctacctgcgtcctgacctcgtccct
gacaccccgtccttctacgagggctcctccatgggaaccatctcctccatctttgtcaag
ctggagacccagtctgaagacagagacgacatggcgtccagctccacattcaccctggag
gacagcgccatctgtctgacgtcagagcagagcaccatggacgtagaggtggacatggac
caggacgatggctcagtgctcgacgtctacttatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250823
Entry
112250823         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112250823
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112250823
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112250823
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250823
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112250823
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112250823
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112250823
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112250823
 Endosome - Golgi transport
  Others
   Others
    112250823
SSDB
Motif
Pfam: PIP5K Toxin_33
Other DBs
NCBI-GeneID: 112250823
NCBI-ProteinID: XP_024277052
LinkDB
Position
5
AA seq 718 aa
MEAAAEGAVGLSEARPLSGATASEDADTVIGISYGRDSDMDYSARKAHITELPGVSGLPG
QGKRMGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESI
FFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGAS
GSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCIQSGGKNI
RMVVMNNVLPRAVRMHLKFDLKGSTYKRCASKKERQKAKPTFKDLDFMQDLQDGLMLDQD
MYSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAEREQQMEGGEKDEKRPVAQKALYS
TAMESIQGGAACGESIETDDTMGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKA
MVHDGDTVSVHRPGFYADRFFKFMSSTVFKKSSSLKSSPIKKGRVGLTVTKYTGPGAAWS
ASQLPSERDDNIYDLRGARSFPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTTSLSI
PERSPSDAGAEHPRYRYQNNSSERRRHTQSVSHDGRTQEEVHEEEQQTITVEVEVKRHDS
EPTITAPQPSPETSELPELASAAASPPASGAPAEASAETPGPGATVSPKVVVVEAERDRR
GSTVSGSGCTSQASQDDEDDVPITDIYFPPEDKTWVYSPLHYGSESQTLPDGEESETS
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggaagcagcagccgagggagcagttgggctgtcagaggcgagaccgttatccggggct
acagcatcagaggatgcggacactgtcattggaattagctacggaagggacagtgacatg
gactattctgctagaaaagcacacatcacagagctgcctggtgtctcgggtctaccaggc
caggggaagaggatgggccacaggggagtggacgcgtccggagaaaccacctacaagaag
accacgtcctccgccctgaaaggtgccatccagctgggcatcggctacacggtgggcaac
ctgagctccaagcctgagagagacgtcctcatgcaggacttctatgtggtggagagcatc
ttcttccccagtgaaggcagcaacctgactccagcccaccacttcccagacttccgcttc
aagacgtatgctcctgtggccttccgctacttcagggagctctttgggatcaggcctgat
gactacctgtactccctgtgtaacgagcccctgattgagttgtccaaccccggggccagt
ggctctgtgttctacctgaccaaggacgatgagttcattatcaagaccgtcatgcacaag
gaggcagagtttctgcagaagctgctgcctggatactacatgaacctcaaccagaaccct
cgcaccctgcttcccaagttcttcggcctgtactgcatccaatctggcggtaagaacatc
cgcatggtggtcatgaacaatgttctaccgcgcgccgtccgcatgcacctcaagtttgac
ctgaagggctccacctataaacgctgtgcctccaagaaggagagacagaaagccaagccc
accttcaaagacctggacttcatgcaggacctgcaggatggcctgatgctagaccaggat
atgtacagcgctctggtcaagaccctgcagagagactgtttggtgctggagagctttaag
atcatggactacagcttgctgctgggggtccataacatcgaccaggcagagagggagcag
cagatggagggaggagagaaggatgagaagaggcccgtggcccagaaggccctctactcc
accgccatggagtctattcagggaggggctgcctgcggggagtctatcgaaacagacgac
acgatgggaggcatcccagcagtcaatgggaaaggagagcgtctactcctctacatcgga
atcatagacatcctgcaatcctacaggctaataaagaagctggagcacacatggaaggct
atggttcatgatggggacaccgtatcagtccaccgtcctggcttctatgcagacaggttc
ttcaaatttatgagcagcactgtgtttaagaagagctcatccttgaagtcttctcccatt
aagaagggccgtgtgggcctgacggtgactaagtacactggccccggggccgcctggtca
gccagccagctgccttctgagagagacgacaacatctacgacctgagaggagcacgcagc
ttccccacgctggaggacgaggggcgaccagacctcctcccctgcacccctccgtcattt
gaggaggcgaccacagcctccatcgccaccacgctctcctccaccacctctctgtccatc
ccagagaggtctccctcggacgctggagcagagcacccccgctacaggtaccagaacaac
agctctgagagaaggaggcacacccagtctgtcagccatgacgggaggactcaggaggag
gtgcatgaggaggagcagcagaccatcacggtggaggtggaggtgaagagacacgacagc
gagcccaccatcacggccccacagccctctccagagaccagtgagttaccagaattagcc
tctgctgctgcctctcccccagcctctggggcccctgctgaagcctctgctgagacccct
ggcccaggggccactgtcagtcccaaggttgtggttgtggaggctgagcgggaccgccgg
ggcagcacagtgtctgggtccggatgcaccagccaagcctcacaggatgacgaggatgac
gtgccaatcacagacatctactttccccctgaggacaagacctgggtgtactcccctctg
cactacggcagtgagtctcagaccttgccggatggggaggagagcgagacaagctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252223
Entry
112252223         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112252223
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112252223
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252223
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252223
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112252223
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252223
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112252223
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112252223
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112252223
 Endosome - Golgi transport
  Others
   Others
    112252223
SSDB
Motif
Pfam: PIP5K Toxin_33
Other DBs
NCBI-GeneID: 112252223
NCBI-ProteinID: XP_024279036
LinkDB
Position
6
AA seq 624 aa
MEAALPVAEGAVGLSEAREASPFSGATASEDADTVIGVSYGMDSDFDFSARKAHITELPG
VSGLPGQGKRMGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDF
YVVESVFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIEL
SNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCIQ
SGGKNIRMVVMNNVLPRAVRMHLKFDLKGSTYKRCASKKERQKAKPTFKDLDFMQDLQDG
LMLDQDMYSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAEREQQMEGEEKDEKRPVA
QKALYSTAMESIQGGAACGESIDTDDTMGGIPAVNGKGERLLLYIGIIDILQSYRLIKKL
EHTWKALVHDGDTVSVHRPGFYADRFFKFMSSNVFKKSSSLKSSPIKKGRVGLTVPKYTG
PGAAWSASQLPSEGDDNIYDLRGARSFPTLEDEGRPDLLPCTPPSFEEATTASIATTLSS
TTSLSIPERSPSDAGAENPRYRYQNNSSERRRHTQSVSHDGRTQEEMREEEQQTITVEVE
VKRHDSEPIITAPQPSPETSEIPR
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggaagcagcactgccagtagctgagggagcggttgggctgtcagaggccagggaagcg
agtcctttttccggggccaccgcatccgaggatgcggacactgtcattggagtaagctat
ggaatggatagcgacttcgatttttctgctagaaaagcacacatcactgagctgcctggt
gtctcaggcctaccaggccaggggaagaggatgggccacaggggagtggacgcgtccgga
gagaccacctacaagaagaccacgtcgtctgccctgaaaggtgccatccagctgggcatc
ggctacacagtgggcaacctgagctccaagcctgagagagacgtcctcatgcaggacttc
tatgtggtggagagtgtcttctttcccagtgaaggcagcaacctgactcctgcccaccac
ttcccagacttccgttttaagacgtacgctcccgtggccttccgctacttcagggagctc
tttgggatcaggcccgatgactacctgtactccctgtgtaacgagcccctgattgagttg
tccaaccccggggccagtggctctgtgttctacctgaccaaggacgatgagttcatcatc
aagaccgttatgcacaaggaggccgagtttctacagaagctgctgcctggctactacatg
aacctcaaccagaaccctcgtaccctgctccccaagttcttcggcctgtactgcatccag
tctggcggtaagaacatccgcatggtggtcatgaacaatgttctaccgcgcgccgtccgc
atgcacctcaagttcgacctgaagggctccacctataaacgctgtgcctccaagaaggag
agacagaaggccaagcccaccttcaaagacctggacttcatgcaggacctgcaggatggc
ctgatgctggaccaggatatgtacagcgctctggtcaagacactgcagagagactgtctg
gtgctggagagctttaagatcatggactacagcttgctgctgggggtccataacatcgac
caggcagagcgggagcagcagatggagggggaagagaaggatgagaagaggcccgtggcc
cagaaggccctctactccaccgccatggagtccatccagggaggggccgcctgcggagag
tctatcgacactgatgacacgatgggcggcatcccagcagtcaacgggaaaggagagcgt
ctactcctctacattggaatcatcgacatcctgcaatcctacaggttaataaagaaactg
gagcacacgtggaaggctttggttcacgatggggacaccgtatcggtccatcggcctggc
ttctatgcagacaggttcttcaaattcatgagcagcaatgtgttcaagaagagctcctcc
ttgaagtcttctcccattaagaagggtcgtgtgggcctgacagtgcctaagtacaccggc
cctggagccgcctggtcagccagccagttgccctcggagggagacgataacatatatgac
ctgagaggagcacgcagcttccccacgctggaggacgaggggcgaccagaccttctaccc
tgcacccctccgtcgtttgaggaggcgaccacggcctccatcgccaccacgctctcctcc
accacctctctgtccatcccagagaggtctccctcagatgctggagcagagaacccccgc
tacaggtaccagaacaacagctctgagagaaggaggcacacccagtctgtcagccatgac
gggaggacccaggaggagatgcgtgaggaggagcagcagaccatcacggtggaggtggag
gtgaagagacatgacagcgagcccatcatcacggccccacagccatctccagagaccagt
gagataccaaggtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260798
Entry
112260798         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112260798
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112260798
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112260798
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260798
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260798
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112260798
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112260798
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112260798
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112260798
 Endosome - Golgi transport
  Others
   Others
    112260798
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112260798
NCBI-ProteinID: XP_024291916
LinkDB
Position
10
AA seq 384 aa
MDEIATSGEAGGSMPTSGAERSDQIDTVGFLLKLSSADMDTGHRESTITSEMPSPTAQGL
GPGQEKKIGHRRVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVV
ESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNP
GASGSIFYVTRDDEFIIKTVNAKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQCGG
KNIRIVVMNNVLPRAVRMHLKFDLKGSTYKRRASKKEREKSNPTFKDLDFIADVPDGLTL
DQDTYGALLKTLQRDCLVLESFKIMDYSLLLGVHNLGQAGRESQGSPAGGDEKKPVTQRA
LYSTAMESIQGGKMCRDTLDHDAT
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatgagattgcgacatcgggggaggccgggggaagcatgcccacgtctggggcggag
agatcggaccagatagatacggtcggattcttgctcaagctttcttctgcagacatggac
actggtcatagggagtctacaataactagtgagatgccgtcccccacagctcagggtcta
ggcccaggtcaggagaagaagatcggccacaggagagtagatgcctctggagagaccacc
tataagaagaccacgtcctctgccctgaaaggtgccatccagctgggcatcggctacacg
gtgggcaacctgagctccaagccagagagagatgtcctcatgcaggacttctatgtggtg
gagagcattttcttccccagtgagggtagtaacctgactcctgcacatcactacccagac
ttcaggtttaagacctacgccccagtggccttccgctacttcagagagctgtttgggatc
cgacccgatgactacctgtactctctatgtaacgagcccctgatcgagctgtccaacccg
ggggccagcggctccatattctatgtaaccagggacgatgagttcatcatcaaaacagtc
aatgccaaggaggcggagtttctgcagaaactacttcctggatactacatgaatctgaat
cagaacccgaggaccctgcttcctaagttctttggtctctactgcgtccagtgtggtggt
aaaaacatccgtatcgtggtcatgaacaatgtgttaccgcgcgccgtacgcatgcacctc
aagtttgacctgaagggctccacgtataaacggcgtgcgtcgaagaaagagagggagaaa
tctaatcccacctttaaagatctggactttatagcagatgtaccggacggactgacactg
gatcaagatacatatggtgctctgcttaagaccctacagagagattgtctggtgctagag
agctttaaaatcatggattacagtctgttgctgggggtccataacctgggccaggctggg
agagagtcccagggctcaccagcagggggcgatgagaagaaacctgtgacccagagagcc
ctctactctactgccatggagtctatacagggagggaagatgtgtagagacacactagac
cacgatgctacgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263935
Entry
112263935         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta-like
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112263935
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112263935
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112263935
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263935
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112263935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112263935
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112263935
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112263935
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112263935
 Endosome - Golgi transport
  Others
   Others
    112263935
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112263935
NCBI-ProteinID: XP_024296329
LinkDB
Position
12
AA seq 537 aa
MSTTTENGVGGYRNTSGEKTYKKTTSSALKGAIQLGIGYTVGNLTSKPDRDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICNEPLIELSNP
GASGSLFYLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCIQSGG
VNIRLVVMNNVLPRSVKMNYKYDLKGSTYKRRASRKEREKACPVYKDLDFQDMHEGLYFD
ADTYNALMKTLQRDCLVLESFKIMDYSLLLAVHVLDQSPKEGGEPGQAVGDGKRPVAQRV
LYSTAMESIQGDGKAAEAHTTDDTMGGIPAKSHKEEKLLIFLGIIDILQSYRFIKKLEHS
WKALVYDGDSVSVHRPGFYANRFLKFMSTSVFRKTPTIRFSPSKRTRTSIPALKSSSQEI
LSSQKEEEERRQSLGGARSLASLDGQVFGSYLRPDLVPTPIFLTGDSESSGFVTGIGCHL
GLLFVFLVLLFPLRDEMASSSTFTLQDSAICLTSEQSTMDVEVDMDRDDGSVLDVYL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgtcaacgaccacagaaaatggagtgggagggtatcggaacacaagcggagagaaaaca
tacaagaagaccacgtcgtcggccctgaagggggccatccagttgggcatcggctacacg
gtgggaaacttgacctccaaacctgacagagatgttctcatgcaggacttctacgttgtg
gagagtgtcttcctgcccagtgaagggagcaacctgacaccggcgcaccactacccagac
ttccgcttcaaaacctacgccccgctggccttccgctacttcagagagctcttcgggatc
aaaccagatgactacctgtactctatctgtaatgagcctctgattgagctgtccaatccc
ggggccagcggctctctgttctacctgaccagcgatgacgagttcataatcaaaaccgtc
cagcacaaagaggcagagtttctccagaaattactcccaggttactacatgaacctgaac
cagaacccacgcacgctgttgcctaagttctatggtctatactgcatccagtctggaggc
gtcaacatccggctggtggtgatgaacaacgtgctgccgcgctctgtcaagatgaactac
aagtacgatctgaagggctccacctacaagagacgtgcctccaggaaggagagggagaag
gcctgtcccgtctacaaggacttggacttccaggacatgcatgaagggctctactttgac
gctgacacctacaatgcgctgatgaagaccctacagagagactgcctggtgttggagagc
tttaagatcatggactacagtctgcttctggccgtgcatgttctggaccagagcccgaag
gagggcggcgagccgggccaggcagtgggggatggcaagcggcccgtggcccagagggtc
ctctactccacagccatggagtctatccagggggacggcaaggctgccgaggcccacacc
acagacgacacgatgggtggaattcctgccaagtcacacaaagaagagaagctgcttatt
ttcctgggcatcatcgacatcctgcagtcctacagattcattaagaagttggaacactca
tggaaggccctggtctacgacggtgactctgtctcggtgcaccggcctggtttctatgcc
aaccgattcctcaagttcatgagcacttcggtgttccggaagactccgaccattcgcttc
tccccttctaagaggactcgtacatccatccctgctctgaagtcgtcctctcaggagatc
ctgtcttctcagaaggaagaggaggagaggaggcagagtctgggaggagcacgcagtctg
gccagtctagacggacaagtgtttggctcctacctgcgtcctgacctagtcccgacaccc
atcttcctaacgggtgactcagagtcctcaggctttgtgacaggaatagggtgccatttg
ggactcttatttgtgtttcttgttctcctgtttcccctcagagatgaaatggcgtccagc
tcaacattcaccctgcaggacagcgccatctgtctgacttcagagcagagcaccatggac
gtagaggtggacatggaccgggatgatggctcagtgctcgatgtctacttatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266614
Entry
112266614         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 alpha-like
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
otw04144  Endocytosis
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Module
otw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112266614
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112266614
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112266614
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266614
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112266614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112266614
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     112266614
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112266614
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    112266614
 Endosome - Golgi transport
  Others
   Others
    112266614
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 112266614
NCBI-ProteinID: XP_024300013
LinkDB
Position
14
AA seq 584 aa
MATAGTVHSGPASSTVGSTGTQKIASLEVLGSSGSSQTIKKTIGHRGLDPTGETTYKKTT
SSALKGAIQLGITHTVGSLSQKPERDVLMQDFEVVESIFFPSEGSNLTPGHHYSDFRFKT
YAPIAFRYFREMFGIRPDDYLYSLCNEELIELSNSGASGSLFYVSSDDEFIIKTVQHKEA
EFLQKLLPGYFMNLNQNKRTLLPKFYGLYCIQAGGKNIRIVVMNNLLPRAVRMHLKYDMK
GSTYKRRASAKERERAVPTFKDLDFIQDLPDGLLLEPDNYNALSKTIQRDCLLLQSFKIM
DYSMLVGIHNLEQAARERAGEEVADQRPPPSQGQKSLYCTAIEAIQGEAHGKGAVDTEDN
MGGIPARNSKGKRMLVYIGIIDILQSYRFVKKIEHSWKALVHDGDTVSVHRPGFYADRFQ
KFMCNTVFKKIPLKTSPSKKNRVGTQGGLRRANTASSRPFPFPQPSSSSSLGVPHSQSTE
TEGVSMVQSGCPDIPPNTPTHDVVTSNSVETTLFNSLLGSSKLATTAPSVRSVGEEVHEA
ASTEDTSTPKSFEAVTSVSSVDECIGGCDVISLSDIVPQTSSCY
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggccacagccggaacagttcattcaggtccagcgagttccactgtaggctcaactggg
actcagaagatagcttctttagaggttctagggtcctcaggctcgtctcaaactataaag
aagactattggccaccgtgggcttgaccccactggggagaccacctacaagaagactacc
tcgtctgccctgaaaggtgccatccagttgggcatcacacacacagtgggcagcctgagc
caaaaacctgagagagatgtactcatgcaggactttgaagtggtggagagcatctttttc
cccagtgagggcagtaacctgaccccaggccaccactacagtgacttcaggttcaagacc
tacgctcccatcgccttccgctacttcagggagatgtttggtatccgaccagacgattac
ctgtactctctgtgtaacgaggaactgattgagctgtccaactctggagccagcggatct
ctgttctacgtctccagcgatgacgagttcatcattaagactgtgcagcacaaagaggct
gagttcttacagaaactattgcctggctacttcatgaacctgaaccagaacaagcgaacc
ttgctgccaaagttctacggtctctactgcattcaggcagggggaaagaacatccgcatt
gttgtcatgaacaacctgctcccgcgcgccgtgcgcatgcacctcaagtacgacatgaag
ggctccacctataagagacgagcctcggccaaggagcgagaaagggctgtgcccacgttc
aaggatctggacttcatccaggaccttcccgatggtcttctgttggaaccagacaattac
aacgccctcagcaagaccatccagagagactgcctgctgctacagagctttaagatcatg
gactacagcatgctggtggggatccacaacctggagcaggcggcccgggagcgggctgga
gaggaggtggccgaccagaggcccccaccgtctcagggccaaaagtccctctactgcact
gccatagaggccatccaaggagaggcgcacggcaagggagcagtggacactgaggacaac
atgggaggtattccagcacgcaattccaagggcaagaggatgctggtgtacattggtata
atcgacattctgcagtcctacaggtttgtgaagaagatcgagcactcctggaaagctctg
gtccatgatggggatacagtgtcagtgcacagaccaggtttctacgctgaccgctttcag
aaattcatgtgcaacacagtcttcaagaagattccattgaagacatccccgtcaaagaag
aaccgagtggggacccagggaggcttacggagggccaacactgcaagctccagacccttt
ccattcccccagcccagcagtagcagcagcctaggagtcccacactcccaaagtacagag
actgagggagtcagcatggtgcagtcaggatgccctgacataccaccaaatacacccaca
catgatgttgtcaccagtaactctgttgaaacaaccctcttcaattccttgttgggaagc
tcgaagctcgctaccacagctccctctgtcagatctgtgggagaggaggtccatgaggca
gccagtacagaggacactagcacccccaaaagttttgaagcagtgacctcagtgtcgtca
gttgatgagtgcatcggtggatgtgacgtcatctcactcagtgacatagttcctcagaca
agcagctgttattga

DBGET integrated database retrieval system