KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220405
Entry
112220405         CDS       T05605                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220405
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112220405
   04114 Oocyte meiosis
    112220405
   04115 p53 signaling pathway
    112220405
   04218 Cellular senescence
    112220405
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112220405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112220405
   03036 Chromosome and associated proteins [BR:otw03036]
    112220405
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112220405
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112220405
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112220405
NCBI-ProteinID: XP_024238066
LinkDB
Position
20
AA seq 403 aa
MAHRMTRNRLGSSENQTALPGKVVLGTKPTLRTRAALGEIGNVGVPRQTLKKDAKAEPTK
VVDRKASTRLATVPEVQQPPKMVISPVKLEVQVFPEPLSPTAMETSGCAPIELCQAFSDV
LLNIKDVDADDYDNPMLCSEYVKDIYKYLQKLEVDQAVKTKYLEGQEITGNMRAILIDWL
VQVQIKFRLLQETMYMTVGIIDRFLQDNPVPKKQLQLVGVTAMFIASKYEEMYPPEIADF
AFVTDRAYTTAQIRDMEMMILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYLVEL
TMVDYEMVHFPPSQVASAAFALTLKVFNCGDWSSTLQHYMNYTEDCLVPVMRHIAKNVVK
VNEGQTKHMAVKNKYSSQKHMKIATISQLKSSLIKDLAKQLTL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctcaccgtatgaccagaaatcgtctgggttcctcagagaaccaaactgccctgcca
ggcaaggtggttctgggaaccaagcctacactgagaacacgagctgcgcttggcgaaatc
ggaaatgttggagtccccagacagactctgaaaaaggatgcaaaggcagaacccacaaag
gtggttgataggaaggccagcacacggttggcgacggtcccagaagtccaacaaccccca
aaaatggttatttccccagttaagctggaggttcaggttttccctgagccattgtctccc
acagcaatggagacctctggctgtgctcccattgaactgtgccaggccttctctgatgtc
ctacttaatattaaagatgtggatgctgatgactatgacaaccccatgctctgtagtgaa
tatgtgaaggacatctacaaataccttcaaaaacttgaggttgatcaggctgttaaaacc
aaatatctggaaggacaggaaattacaggcaacatgcgtgccattctcattgattggctc
gtccaggtccaaatcaagttccgcctgctgcaggagaccatgtatatgactgtgggaatc
attgaccgcttccttcaggataacccagtgcccaaaaagcaacttcagttggttggtgtg
actgccatgttcatcgcctccaaatacgaggagatgtaccctccagagattgcagacttt
gcatttgtgactgaccgggcctacaccactgcccagatcagggacatggaaatgatgata
ctgagagtgctgaagttcagctttggccgccctctccccctccagttcctcagaagggcc
tcaaagattggcgaggtgactgctgagcaccacaccctggcaaagtacttggtggagctc
accatggtggactatgagatggtgcacttccctccctcccaggtggccagtgcagccttc
gccctcaccctgaaggtcttcaactgcggtgactggagttccacactgcagcattacatg
aactacaccgaagactgcctagtcccggtcatgcggcacatagcaaaaaatgttgtgaag
gtgaacgagggacaaactaagcatatggcagttaagaataagtactctagtcagaagcat
atgaaaatcgccaccatttcacagctgaagtcttcgctgatcaaggaccttgcaaagcag
ctcaccctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230962
Entry
112230962         CDS       T05605                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112230962
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112230962
   04114 Oocyte meiosis
    112230962
   04115 p53 signaling pathway
    112230962
   04218 Cellular senescence
    112230962
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112230962
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112230962
   03036 Chromosome and associated proteins [BR:otw03036]
    112230962
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112230962
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112230962
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112230962
NCBI-ProteinID: XP_024253168
LinkDB
Position
33
AA seq 399 aa
MALPMTRSRLASSENQTTLPGKAVLGTKPTLRPRAALGEIGNVGVPRQTLKKNAKAETTK
VVDRKTSTRAEKAQVVQPPKIVVFAPVQVLPEPMSPTPMETSGCAPNELCQAFSDVLLNI
KDVDADDYDNPMLCSDYVKDIYKYLQKLEIDQAVKPNYLEGQEITGNMRAILIDWLVQVQ
IKFRLLQETMFMTVGIIDRFLQDNPVPKKQLQLVGVTAMFIASKYEEMYPPEIVDFAFVT
DQAYTTAQIRDMEMKILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYFVELTMVD
YEMVHFPPSQVASAAFALTLKVFNCGKWSSTLQHYMNYTEDSLVHAMQHIAKNVLKVNEG
QTKHMTVKNKYSSQKQMRIATISQLKSSLIKDLAKQLTL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctctccctatgaccagaagtcgcctggcttcctcagagaaccaaactactctgccg
ggcaaggctgttttgggaactaagcctacactgagaccacgagctgcgctcggtgaaatc
ggaaatgttggagtccccagacagactttgaaaaagaatgcaaaggcagaaaccactaag
gtggttgacaggaagaccagcacgcgggctgaaaaagcccaggtagttcaaccaccaaaa
atagtagtttttgcccctgttcaggttttgcctgagccaatgtcgcccacaccaatggag
acctctggctgtgctcccaatgagctgtgccaggccttctcagatgtcctacttaatatc
aaggatgtagatgctgacgactacgacaaccccatgctctgcagtgactatgtgaaggac
atctacaaatatctccagaaacttgagattgatcaggctgtcaaacccaactatctggag
ggacaggaaattacaggcaacatgcgtgctatcctcatcgattggcttgtccaggtccaa
atcaagttccgcctgctgcaggagaccatgttcatgactgtgggaatcattgatcgcttc
cttcaggataacccagtgcccaaaaagcagctccagcttgttggtgtgacagccatgttc
attgcctccaaatatgaggagatgtaccctccggagatcgtagactttgcctttgttacc
gaccaggcctacaccactgcacagatcagggacatggagatgaagatcctaagggtgctg
aagttcagctttggccgccctctccccctccagttcctcagaagggcctcaaagatcggc
gaggtgactgctgagcaccacaccctggcaaagtactttgtggagctcaccatggtggac
tacgagatggtgcacttccctccctcccaggtggccagcgcagcctttgccctcaccctg
aaggtcttcaactgcggcaaatggagctccacactacagcattacatgaactacacagaa
gacagcctggtccatgccatgcagcacatcgctaaaaatgttctgaaggtgaacgaggga
caaactaagcatatgacggttaagaacaagtactctagtcagaagcagatgagaattgca
actatttcacagctaaagtcttcgctgatcaaggaccttgcaaaacaactcaccctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231150
Entry
112231150         CDS       T05605                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B3-like isoform X1
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112231150
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112231150
   04218 Cellular senescence
    112231150
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112231150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112231150
   03036 Chromosome and associated proteins [BR:otw03036]
    112231150
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112231150
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112231150
SSDB
Motif
Pfam: Cyclin_N Cyclin_C PRD_Mga Translin
Other DBs
NCBI-GeneID: 112231150
NCBI-ProteinID: XP_024253496
LinkDB
Position
33
AA seq 406 aa
MPFSRGKNPSSIKVPGKGSLGVMENQEGVLSKRSSPQGGVKKRSAFVDITNATKIQMNNQ
TKIGKPAKKALRSKEAAKNEANLKEPKAVCSNGQSMKLEVGLSPEKDLVVWPQEETTLCP
GRQVVPDEFDIDKEFYGDVSMSAEYAKEIFDYLREREEKFVLKDYMNSQPDLNKDMRGIL
VDWMVELQENFELNHETLYLAVKLMDHYLACSVIMRESLQLIGSTAMLIASKFEERTPPC
IDDFLYICDDAYNREEIIAMEINILQALQFDINIPVPYRFLRRYAKCVSASMETLTLARY
VCELSLLELQQVPERGSRLAAACLLLALITKGLGGWTAMLEYHTGYTVKELTPLVKTLRT
MLACPTDDKLTAVTTKYSHIVFFEVACIPLVAVQTLEDALIEQQVS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgcctttctcaagaggaaagaacccctcttccatcaaagttcctggaaaaggatcgtta
ggtgtgatggagaatcaggagggtgttctcagtaagaggtcttctccacagggtggcgta
aagaaaaggtctgcctttgttgacatcactaatgccaccaagattcaaatgaacaaccag
accaagattgggaagcctgccaagaaggcacttaggagcaaagaagctgccaagaatgaa
gctaatctgaaagaacctaaagctgtgtgctctaatgggcaatctatgaagttggaggtg
ggcctatccccagagaaagacctggtggtttggccacaggaggagactactctttgccca
gggagacaggtggtgcctgacgagtttgacattgacaaggaattctatggtgacgtttcc
atgagcgccgagtatgccaaggaaatatttgactacctgagggagagagaggagaagttt
gttttaaaggattacatgaacagtcagccggacttgaacaaagacatgagagggattctg
gtggattggatggttgaacttcaggaaaactttgagcttaaccacgagaccctgtacctg
gcggtaaagctgatggaccactacctggcctgcagcgtcatcatgagggagagcctgcag
ctcattggctccacagccatgctcatcgcctccaagtttgaggaacgcactccgccatgc
attgatgatttcctgtacatctgcgatgacgcctacaaccgggaagagattattgccatg
gagataaacatcttgcaggcactgcagtttgatatcaacattccagtcccttaccgcttt
ctccgacgctatgccaagtgtgtgagcgccagcatggagaccctgacgttggctcgctat
gtgtgtgagctgagccttctggagctgcagcaggttcctgagagaggctctcgcctagct
gctgcctgcctgctcctggccctcatcactaaaggcctgggaggatggacagccatgcta
gagtaccacactggctacactgtgaaggagctaacccccctggtgaagacgctgcgcacc
atgctagcctgtcctactgatgacaagctgacagccgtcactaccaagtattcccacata
gtgttctttgaggtagcgtgtattcccttggtggctgtccagacactagaagatgctctg
atagagcagcaagtctcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249181
Entry
112249181         CDS       T05605                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2-like isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112249181
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112249181
   04114 Oocyte meiosis
    112249181
   04115 p53 signaling pathway
    112249181
   04218 Cellular senescence
    112249181
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112249181
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112249181
   03036 Chromosome and associated proteins [BR:otw03036]
    112249181
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112249181
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112249181
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112249181
NCBI-ProteinID: XP_024274670
LinkDB
Position
4
AA seq 409 aa
MSSLEVRAALWNADNPALMGKANVAGARRAVLGELSNFPNASKAVPSKKTVAAAKASTKQ
SMNQKDQPAAVRTKRSPVPQPEESANVSMKEEELCQAFSVALLAVEDIDEGDSDMPQLCS
EYIKDIYGYLQCLETQQSVRPKYMDGYEINGRMRALLIDWLIQVHSRFQLLQETLYLTVA
ILDRFLQVSLVKKNGIFLFTFSNPSLIKVQTIGRKKLQLVGVTAMLLASKYEEMYSPEIG
DFVYITDNAFTKAHIREMEQMILHSLNFELGRPLPLHFLRRASKAGNADVEKHTLAKYLM
ELTLLDYDMVHYHPSEIAAAALCLSQLLLDELNWTLTQEHYSTYNENHLKPIMQHIAKNV
VSVTEGRTKLQAVKNKYASSRLMRISLIPQLKSAVVNDMAAALLPEHKP
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtcgtcattggaagttcgtgctgcgttatggaacgcagacaacccagcactaatggga
aaagcaaacgtagctggagcaagaagggctgtgcttggagagctgtccaactttcccaat
gccagcaaagcggtgccgtccaagaagactgttgctgctgctaaggcttcaaccaaacaa
tctatgaaccagaaagaccagccagcagctgttcggactaaacgttccccagttcctcag
cctgaagagtctgctaacgtgtccatgaaagaagaggaattgtgtcaggcgttctcagta
gctctacttgctgtagaagacattgatgaaggggattcagacatgccacaactgtgctct
gaatatataaaggatatctatggatatttgcagtgccttgagacccagcagtctgtccgg
cccaagtacatggatggctatgagatcaatggacgaatgcgcgctctcctgattgactgg
ctgattcaggtgcattccaggttccagctactgcaggagactctatatttgactgtggcc
atcctggatcgctttcttcaggtaagccttgttaaaaaaaatggtatattcctgtttact
ttttctaacccctctcttatcaaggtgcaaactatcggccgcaagaagctccagctggtt
ggcgtgactgccatgttgttggcatccaagtatgaagagatgtattccccggaaattggt
gatttcgtttacatcacagacaatgcattcaccaaggcccatattcgtgagatggaacag
atgattctgcacagtctgaactttgagcttggacggcctctacccctacacttcctcagg
agagcctccaaggctggcaatgctgatgttgagaagcacacactagccaaatacctcatg
gaactgaccctccttgactatgacatggtgcactaccatccttctgagattgctgctgca
gccttgtgcctctcccagctgctgcttgatgagctcaactggactctaacgcaggagcat
tactctacctataatgagaaccacctcaagccaatcatgcagcacatcgccaaaaatgtt
gtctctgtcactgaagggcgaacaaagcttcaggctgtcaagaacaagtatgcaagcagc
aggctaatgaggatcagcctcatccctcagctgaagtctgctgttgtaaatgacatggct
gctgctctgctcccagaacataaaccctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259703
Entry
112259703         CDS       T05605                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B3-like
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112259703
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112259703
   04218 Cellular senescence
    112259703
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112259703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112259703
   03036 Chromosome and associated proteins [BR:otw03036]
    112259703
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112259703
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112259703
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112259703
NCBI-ProteinID: XP_024290095
LinkDB
Position
10
AA seq 415 aa
MPFPRGKKPSVTAGSKIPKLRGKGIENQEEGPQVKRSSSPPQGAPKKRTAFVDLTNAHKV
HISLPGTKKNSLKKTQKKKATSTVLDKNEANLKKSESISSESQEEEKQRGEEETPVEQLV
VVEAVPPRELPPHLQGPQIPEEFDIDSQHQDDPTLTAQYAKEIFDYLKAREEKFILSDYM
SIQPSLNAGMRAILVDWLVEVQENFELNHETLYLAVKVTDHFLSAAPVNRENLQLIGSTA
LLIASKFEERCPPCVDDFLYVCDDAYKREEVIAMETSILQALGFDINIPVPYRFLRRYAK
CVSASMETLTLARYVCELSLQEMDLVPERGSLLASACLLLALVTKELGGWSPILVFHSGY
GVSELVPVVRRLHSMLTSPPDDKLLAIRSKYSHKVFFEVATTPMVDLDTLERALK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgccttttcccagggggaagaaaccaagtgttactgctggcagtaaaatacccaaatta
cgtggcaaagggatagagaatcaggaggaaggcccccaggtcaagaggtcgtcgtcccct
ccccaaggagcccctaagaagaggacagccttcgtagacctcaccaatgcacacaaggtt
cacatcagccttccaggtaccaagaagaactcccttaagaagacgcagaagaagaaggcc
acctccactgtgttagacaagaatgaagccaaccttaaaaagtctgaatcaataagctca
gagagtcaggaggaggagaaacagaggggggaggaggagaccccagttgaacagcttgtg
gtggtggaggctgttccacctagagagttgcccccccacctccagggaccacagatccct
gaggagtttgatatagactctcagcaccaggatgaccccactctgactgctcagtacgcc
aaggaaatatttgactacctcaaggccagagaggagaagttcatcctgtctgactatatg
tccatccagcccagtctgaacgctggtatgagggccatcctagtggactggttggtcgag
gtgcaggagaactttgagctgaaccatgagactctgtacctggctgtgaaggtgacagac
cacttcctgtctgcagcgccggtcaacagagagaatctacagcttataggttctacagcc
ttgctcatagcatccaagtttgaggagcgctgtccgccctgtgtggacgacttcctgtat
gtctgtgatgatgcgtacaagagggaggaggttattgctatggagacgagcatcctgcag
gcgctggggttcgacatcaacatccccgtcccctaccgcttcctcaggcgatatgccaag
tgtgtgagtgccagtatggaaactctaaccctggcccggtatgtgtgtgagctgagtctt
caggagatggatctggtaccagagagaggatcattactggcctcagcctgtctgctgttg
gctctagtcaccaaggagctgggaggatggtcccccatcctggtgttccactctgggtac
ggagtgtcagagctggtccctgttgtccggaggctccattccatgctcacctccccgcca
gacgacaaactcctggccatccggagcaagtactctcacaaggttttctttgaagtggcg
acaactccgatggtggacctggacacgttggagagggcgttgaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263712
Entry
112263712         CDS       T05605                                 

Gene name
ccnb2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2 isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112263712 (ccnb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112263712 (ccnb2)
   04114 Oocyte meiosis
    112263712 (ccnb2)
   04115 p53 signaling pathway
    112263712 (ccnb2)
   04218 Cellular senescence
    112263712 (ccnb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112263712 (ccnb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112263712 (ccnb2)
   03036 Chromosome and associated proteins [BR:otw03036]
    112263712 (ccnb2)
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112263712 (ccnb2)
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112263712 (ccnb2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112263712
NCBI-ProteinID: XP_024296015
LinkDB
Position
12
AA seq 379 aa
MSLEVRSALRNADNPTLMGKANVAGAGRAVLGELSNFPNACKAVPFKKTVPAKASTKQSM
NQQDQPAAVWPQVPQPEVYANVSMKEEELCQAFSEALLAVEDIDEGDSDLPQLCSEYIKD
IYGYLQRLETQQSVRAKYMSGYEINGRMRALLIDWLIQVHSRFQLLQETLYLTVAILDRF
LQVQTIGREKLQLVGVTAMLLASKYEEMYSPEIGDFVYITDNAFTKAHIREMEQLILRSL
NFELGRPLPLHFLRRASKAGNADIEKHTLAKYLMELTLLDYDMVHYHPSEIAAAALCLSQ
LLLDELNWTPTQEHYSTYNENHLKPIMEHIAKNIVSVNEGRTKLQAVKNKYSSSRLMRIS
LIPQLKSTFVNYMAAALLQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtcattagaagttcgttctgcgttaaggaacgcagacaacccaacactaatgggaaaa
gcaaacgtagctggagcaggaagggctgtgcttggagagctgtccaactttcccaatgct
tgcaaagcggtgccgttcaagaagaccgttcctgccaaggcctcaaccaaacaatctatg
aaccaacaagaccagccagcagctgtttggcctcaagttcctcagcctgaagtgtatgct
aacgtgtccatgaaggaagaagaattgtgccaggcgttctcagaagctctgcttgctgta
gaagacattgatgaaggggattcagacctgccacaactgtgctctgaatatataaaggat
atctatggatatctgcagcgccttgagacccagcagtctgttcgggccaagtacatgagt
ggctatgagatcaatggacgcatgcgtgctctcctgattgactggctgattcaggtgcac
tccaggttccagctattgcaggagactctctatctgacggtggccatcctggatcgcttt
cttcaggtgcaaactattggccgcgagaagctccagctggttggtgtgactgccatgttg
ttggcgtccaagtatgaagagatgtattccccggagataggtgattttgtttacatcaca
gacaatgcattcaccaaggcccatattcgggagatggagcagctgattctgcgaagtctg
aactttgagcttggacggcctctacccctgcacttcctcaggagagcctccaaggctggc
aatgctgacattgagaagcacacattagccaagtacctcatggaactgaccctcctggac
tatgacatggtgcactaccatccttctgagattgctgctgctgccttgtgcctctcccag
ctgctgcttgatgagctcaactggacaccaacacaggagcactactctacctataatgag
aaccacctcaagccaatcatggagcacattgccaaaaacatagtttctgtcaatgaaggg
cgaacaaagcttcaggctgtcaagaacaagtattcaagcagccgacttatgaggatcagc
ctcatccctcagctgaagtctacctttgtaaattacatggctgctgctctgctccaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264049
Entry
112264049         CDS       T05605                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112264049
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112264049
   04114 Oocyte meiosis
    112264049
   04115 p53 signaling pathway
    112264049
   04218 Cellular senescence
    112264049
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112264049
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112264049
   03036 Chromosome and associated proteins [BR:otw03036]
    112264049
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112264049
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112264049
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112264049
NCBI-ProteinID: XP_024296420
LinkDB
Position
12
AA seq 427 aa
MPYNLRSKLPVKETNTTNQETCAVPNVKVQTKSEENVSLPGKPATSYGLRSRVPLGNVAS
KLNNAKGIKTNTSVPVKPAQCKQSATERVHVISKANTGAGNCDLVRQAKPIAAAPEQPPS
QEATRDEGLNVPQAFSHALLNIPDVDSADAGDSLLCSDYVKDIYAHLRNLEVAMAIKPCH
LEGCDVTGSMRSILVDWLVQVQKQFRLHQETLYMTVGIIDRFLQDYPVPTKSLQLVGVTA
MLIASKYEEIAPPLVKDFAHITDFTYSCAEIRLMEVTILKALNYELGRPPPVHFLRRASK
VGKLQPVGYGLAKYLLELTLLDYASVHHPPSLTAAAALALSSRILHDSAGYEWTPALQHY
TGYTEVSLLPVMQCIAKMLERLSDGSMKQLSIKQKYDNVKLLRVSCLPELTSTRAYAYIN
KLSNSHC
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgccttacaacttgaggtccaaattgcctgtgaaagagaccaacactaccaatcaggag
acatgtgcagttccaaatgtaaaggtccagaccaagtcagaggagaatgtttccttacca
ggaaaacctgccacctcatatggcctgaggtccagggtgcctttgggaaatgtagcaagc
aaactgaacaacgccaaagggattaaaacaaatacgtctgttcccgtcaaaccagctcaa
tgtaagcagagtgccactgaaagagtccatgttatttcaaaggcgaacactggggctggc
aactgtgatctggtcagacaggccaagcccattgcagctgcccctgagcagcctccgagc
caagaggccactcgggacgaggggctcaatgtgccacaggccttctcacatgccctgctc
aacatcccagatgtggactccgcagacgcgggcgactccttgctgtgcagtgactatgtg
aaggacatttacgctcatctaaggaacctggaggttgccatggctataaaaccatgtcat
ctggagggttgtgatgtgactgggagcatgcggagtattctagttgactggctggtacag
gtccagaagcagttcagactgcaccaggagaccctctacatgactgttgggatcattgac
cgctttctccaggactatccagtgccaacgaagtctctgcaactggttggtgtcactgcg
atgctcatcgcttccaagtacgaggaaatcgctcctcccttggtgaaggactttgcccat
ataacagacttcacctactcctgtgctgagatacgcttgatggaagttaccattctgaaa
gccttgaactatgaactgggacgaccaccaccagttcactttctaaggagagcttccaag
gttgggaagcttcagcctgttggttatgggctggctaaatacctgctggagctgaccctt
ctggactatgcctcagttcaccatccaccatccctgaccgctgcagcagctcttgcttta
tcatccaggatccttcatgattctgctggttatgaatggaccccagccctacagcactac
acaggctacacagaggtctctctgctacctgtgatgcaatgcattgccaagatgctggag
cgcttgagtgatggcagcatgaagcagttgtcaatcaagcagaagtatgacaatgtcaag
ctactcagggtcagctgtctcccagagctgacatctaccagggcttacgcctacatcaac
aaactgtccaactctcactgttga

DBGET integrated database retrieval system