KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220930
Entry
112220930         CDS       T05605                                 

Gene name
setd7
Definition
(RefSeq) histone-lysine N-methyltransferase SETD7 isoform X1
  KO
K11431  [histone H3]-lysine4 N-methyltransferase [EC:2.1.1.364]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00310  Lysine degradation
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    112220930 (setd7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220930 (setd7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112220930 (setd7)
Enzymes [BR:otw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.364  [histone H3]-lysine4 N-methyltransferase
     112220930 (setd7)
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     112220930 (setd7)
SSDB
Motif
Pfam: MORN SET
Other DBs
NCBI-GeneID: 112220930
NCBI-ProteinID: XP_024238678
LinkDB
Position
21
AA seq 368 aa
MDSDDDMEEVVEGPLDEDDQPHGFCTVTFSSSDRFEGHFTHGEKNGKGKFFFFDGSTLEG
FYVDDALQGQGVYSYEDGGVLRGTYMDGDLNGPAQEFDSEGRLMFEGQYKDNSRYGECWI
YYPDRGSVFGQVNEDGEMTGKAVAYVYPDGQTALYGSFVEGELIEARLAALVSMETTRPH
FDVSSDSPVYSYDKSTSTCIATHTLLPDPYESKRVFVADSLISGAGEGLFAKMDVEANVV
MAFYNGVRITHSEVDTRDWSLNGNTISLDEDTVIDVPQPFHQMDRYCASLGHKANHSFTP
NCKYDPFVHPRFGPIKCVRTLQAVQRDEELTVAYGYDHEPSGKSGPEAPDWYKQELQAFQ
QRQATNGQ
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggacagcgatgatgatatggaagaagtcgttgaaggccctctggatgaggatgaccag
cctcacgggttctgtacagtcactttctcctccagcgatcgctttgaaggacattttaca
catggagaaaagaatggaaagggcaagttcttctttttcgatggcagcaccttggagggg
ttctatgtggacgatgcgttacagggtcagggggtatactcgtacgaggatggaggggtc
ctccgtgggacctatatggatggggacctcaacggccctgcacaggagtttgactctgag
ggccggctgatgtttgaaggccagtacaaagacaacagccgctatggggagtgttggatc
tactaccctgaccgtggcagtgtatttgggcaggtgaacgaggatggcgagatgaccggt
aaagcagtggcatatgtttaccctgatggccaaacggctctctacgggagcttcgtggag
ggggagctgatcgaggctcgactcgccgccctggtttccatggagaccaccagaccacac
tttgacgtttcatctgacagccctgtgtactcctatgataaatccacttccacctgtatc
gctacccacactcttcttccagacccctatgaaagcaaaagggtatttgtggcagactca
ctgatctcaggtgcaggagaaggcttgtttgccaagatggatgttgaggccaatgttgta
atggccttttacaacggagtacgcatcacacactcggaggtagacactagggattggtcc
ctgaacgggaataccatctccctggatgaggacacggtgatcgacgttccacagcccttc
caccagatggacagatactgtgcctcgctgggacacaaggccaatcactccttcacccca
aactgcaaatacgacccattcgtccaccctcgttttggacccatcaagtgcgtccgcacc
ctgcaggcggtgcagagggatgaggagctgactgttgcctatggttacgaccacgagcca
tcggggaagagcggtccagaagcaccagactggtacaaacaggaactgcaggccttccag
caaagacaggctaccaacgggcagtaa

DBGET integrated database retrieval system