KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221240
Entry
112221240         CDS       T05605                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221240
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112221240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112221240
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112221240
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112221240
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   112221240
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 112221240
NCBI-ProteinID: XP_024239170
LinkDB
Position
21
AA seq 159 aa
MTDAEITFLPVGQDNERFGSNLLDNKKLTRLYCMNGGHHLQILPDGTVEGNRDENDIHTV
LRVKSVDRGVVVIQGTEAGRYLAMSSEGKLYSSSIVTDQCYFLERIEVNHYNTYQAQKYQ
DRSWYVGLKKNGKPKLGSRTHIGQKAIFFLPRRLEGTGE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacggatgcagaaataacgtttttaccggtggggcaggataatgagagattcggaagt
aacctgctcgacaataaaaagctgacccgcctatactgcatgaatggcggacatcatctg
cagattctcccggatgggaccgtggaaggcaacagggacgagaatgacattcacacggtc
ctgcgggtgaaatctgtggaccgtggtgtggttgtcatccaggggacagaggcaggacgc
tacttggccatgagcagtgaaggaaagctctacagttcatccatagtaactgaccagtgt
tatttcctggagaggattgaggtgaaccactacaacacctaccaggcccagaagtaccaa
gacaggagttggtacgtgggactgaagaagaacgggaaacccaaactaggctccagaacc
cacatagggcagaaggccatcttcttcttgccacggcggttggagggcacaggggagtga

DBGET integrated database retrieval system