KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221653Help
Entry
112221653         CDS       T05605                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00030  Pentose phosphate pathway
otw00051  Fructose and mannose metabolism
otw00052  Galactose metabolism
otw01100  Metabolic pathways
otw01200  Carbon metabolism
otw01230  Biosynthesis of amino acids
otw03018  RNA degradation
Module
otw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112221653
   00030 Pentose phosphate pathway
    112221653
   00051 Fructose and mannose metabolism
    112221653
   00052 Galactose metabolism
    112221653
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    112221653
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112221653
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:otw03019]
    112221653
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     112221653
Protein phosphatases and associated proteins [BR:otw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112221653
Messenger RNA biogenesis [BR:otw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     112221653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 112221653
NCBI-ProteinID: XP_024239625
LinkDB All DBs
Position
22
AA seq 793 aa AA seqDB search
MSHTSMDPTKMGIGRSIAVLTSGGDAQGMNAAVRATVRVGIYTGAKVYFVHEGYQGLVDG
GDNIKLATWESVSMMLQLGGTVIGSARCMDFRAREGRMKAALNLVKLGITNLCVIGGDGS
LTGANQFRKEWATLLVDLVKAGKITDDEARKSCHLNIVGMVGSIDNDFCGTDMTIGTDSA
LHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPDEGWEG
HLCRRLADQRARGSRLNVIIVAEGAMDRAGNPISSEDIKKLVEKNLGFDTRTTVLGHVQR
GGTPSAFDRILGSRMGVEAVMALLEATPETPACVVSLSGNQAVRLPLMECVQVTKDVTTA
MAEXRWEDAIKLRGKSFENNWNTYKMLAHINPPDTKSNINVAIVNIGAPCAGMNAAVRSA
VRIGIIQGHNMLAVHDGFEGLAQGKIEPITWTGVSGWTGKGGSELGTKRVLPSEYIEEIS
LTIAKFNIHSLVIIGGFEAYMGGLELVQGRDKYEELCIPMVVIPATVSNNVPGSDFSIGA
DTALNTITSTCDRIKQSAAGTKRRVFIIETAGGYCGYLATMAGLAAGADAAYIYEDKFGI
RDLEMNVEHLVQKMKTDVKRGLILRNENCNANYTTDFIFALYSEEGKGIFDCRKNVLGHM
QQGGTPTPFDRNFGTKMGSKAVLWITEKLKEVYRHGRIFANTPDSACVLGMKKRALTFQP
LAELKEQTDFVHRIPKTSWWLKLRPIMKILAKYNISLDTSEHAHMEHVIKKRVSMPAPLM
KKACPPTKHEEEE
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatacaagcatggatccaaccaagatgggcatcggccggtctatagccgtgctg
acgtctggtggtgatgcccaaggtatgaacgcggccgtgagggccacagtcagagttggt
atctacaccggagccaaggtctactttgttcatgagggttaccagggtctggtggatgga
ggagacaacatcaaactggccacctgggagagtgtgtccatgatgctgcaactgggtggc
acagtcatcggcagtgcccgctgcatggacttcagagccagggagggccgcatgaaggct
gccctgaacctggtcaagctgggcatcaccaacctgtgtgtgattgggggtgacggtagc
ttgactggagctaaccagttcaggaaggagtgggccactctgctggtcgacctggtcaaa
gccggtaaaattacagatgacgaggcccggaaatcgtgccacctgaacatcgtaggcatg
gtgggttctatcgacaatgacttctgtgggacagacatgaccatcgggactgactctgct
ctgcaccgcatcatagaggtggtggatgccatcaccactaccgcacagagtcaccagagg
accttcatcctggaggtgatgggtagacactgtggctacctggccctggtgactgctctg
gcctgtggtgctgactgggtgttcatcccagagatgcccccagatgagggatgggagggg
catctgtgcagaagactggctgatcaacgagccagaggatctcgtctgaatgtgattatt
gtggctgagggagctatggacagagctggaaaccccattagctctgaagacatcaagaag
ctggtggagaagaatttgggctttgacacccgtaccactgtccttggacacgtgcagaga
ggcggcactccctcagccttcgacagaatcctgggcagcaggatgggtgtggaggctgtg
atggccctgttggaggccactccagagaccccggcctgtgtggtcagtctgtccggtaac
caggccgtcaggctgcccctcatggagtgtgtccaagtgactaaggatgtgactactgcc
atggctgagaamagatgggaggatgctatcaagctcagaggaaagagctttgaaaataac
tggaacacatacaagatgctygcccacatcaaccctccagataccaagagcaacattaac
gtggctatagtaaacattggtgctccatgtgctggtatgaatgctgctgtgcgttctgca
gtgaggatcggcatcattcagggacacaacatgttggccgttcatgacgggttcgagggt
ctcgctcaaggaaagattgagcctatcacctggactggagtgtcaggctggactggaaag
gggggctctgagttgggcaccaagagagtccttccttctgagtacattgaggaaatcagc
ttgactatcgctaagttcaatatccactctctggtgattattggagggttcgaggcgtat
atgggtggtctggagctggtgcagggcagagataagtatgaagagctgtgcattcccatg
gtggtcatccccgccactgtctccaacaacgtccccggctcagacttcagcatcggagct
gacacagccctcaacaccatcacctcgacctgtgacaggatcaagcagtcagcagcaggc
accaagcgtcgcgtgttcatcattgagaccgcaggagggtactgtggttacctggctacc
atggcaggtctggctgctggggctgatgctgcatacatctatgaggacaaatttggtatt
agagacctggagatgaacgtagagcatctcgtgcagaagatgaagacagatgtgaagaga
ggtttgattctcaggaatgagaactgcaatgccaactacaccacagactttatctttgcc
ctctactctgaggagggcaagggcatctttgactgccgcaagaacgttctgggacacatg
caacagggcggcaccccaacacctttcgaccggaactttggcaccaaaatgggttccaag
gctgttttgtggataacagagaaactcaaggaggtctatagacacggtcgtatcttcgct
aacaccccagactctgcctgtgtgctgggcatgaagaagagagcactgaccttccagcct
cttgctgagctgaaggaacagacagactttgtgcaccgcatccccaaaacatcgtggtgg
ctgaaactgaggccaatcatgaagatccttgctaaatacaacatcagcctggacacatct
gagcatgcccacatggagcatgttatcaagaagagggtgtcgatgccagcgccactgatg
aagaaggcatgtcctcccacgaaacacgaggaggaagagtaa

DBGET integrated database retrieval system